Gene/Proteome Database (LMPD)

LMPD ID
LMP004875
Gene ID
527
Species
Homo sapiens (Human)
Gene Name
ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c
Gene Symbol
ATP6V0C
Synonyms
ATP6C; ATP6L; ATPL; VATL; VPPC; Vma3
Alternate Names
V-type proton ATPase 16 kDa proteolipid subunit; V-ATPase 16 kDa proteolipid subunit; vacuolar H+ ATPase proton channel subunit; vacuolar proton pump 16 kDa proteolipid subunit; vacuolar ATP synthase 16 kDa proteolipid subunit; H(+)-transporting two-sector ATPase, 16 kDa subunit
Chromosome
16
Map Location
16p13.3
Summary
This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. This gene encodes the V0 subunit c. Alternative splicing results in transcript variants. Pseudogenes have been identified on chromosomes 6 and 17. [provided by RefSeq, Nov 2010]
Orthologs
View orthologs and multiple alignments for ATP6V0C

Proteins

V-type proton ATPase 16 kDa proteolipid subunit
Refseq ID NP_001185498
Protein GI 310832382
UniProt ID P27449
mRNA ID NM_001198569
Length 155
RefSeq Status REVIEWED
MSESKSGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEQIMKSIIPVVMAGIIAIYGLVVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK
V-type proton ATPase 16 kDa proteolipid subunit
Refseq ID NP_001685
Protein GI 4502313
UniProt ID P27449
mRNA ID NM_001694
Length 155
RefSeq Status REVIEWED
Protein sequence is identical to GI:310832382 (mRNA isoform)

Gene Information

Entrez Gene ID
527
Gene Name
ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c
Gene Symbol
ATP6V0C
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0010008 TAS:Reactome C endosome membrane
GO:0070062 IDA:UniProt C extracellular vesicular exosome
GO:0005925 IDA:UniProtKB C focal adhesion
GO:0016021 TAS:ProtInc C integral component of membrane
GO:0005765 IDA:UniProtKB C lysosomal membrane
GO:0030670 TAS:Reactome C phagocytic vesicle membrane
GO:0033179 IEA:InterPro C proton-transporting V-type ATPase, V0 domain
GO:0046933 TAS:UniProtKB F proton-transporting ATP synthase activity, rotational mechanism
GO:0046961 TAS:ProtInc F proton-transporting ATPase activity, rotational mechanism
GO:0031625 IPI:UniProtKB F ubiquitin protein ligase binding
GO:0015991 IEA:InterPro P ATP hydrolysis coupled proton transport
GO:0006879 TAS:Reactome P cellular iron ion homeostasis
GO:0008286 TAS:Reactome P insulin receptor signaling pathway
GO:0051701 TAS:Reactome P interaction with host
GO:0090382 TAS:Reactome P phagosome maturation
GO:0030177 IMP:UniProt P positive regulation of Wnt signaling pathway
GO:0015992 TAS:ProtInc P proton transport
GO:0033572 TAS:Reactome P transferrin transport
GO:0055085 TAS:Reactome P transmembrane transport
GO:0016032 IEA:UniProtKB-KW P viral process

KEGG Pathway Links

KEGG Pathway ID Description
hsa04145 Phagosome
hsa05323 Rheumatoid arthritis
hsa04721 Synaptic vesicle cycle
hsa05152 Tuberculosis

Domain Information

InterPro Annotations

Accession Description
IPR000245 V-ATPase proteolipid subunit
IPR011555 V-ATPase proteolipid subunit C, eukaryotic
IPR002379 V-ATPase proteolipid subunit C-like domain

UniProt Annotations

Entry Information

Gene Name
ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c
Protein Entry
VATL_HUMAN
UniProt ID
P27449
Species
Human

Comments

Comment Type Description
Function Proton-conducting pore forming subunit of the membrane integral V0 complex of vacuolar ATPase. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.
Interaction Q96G23:CERS2; NbExp=3; IntAct=EBI-721179, EBI-1057080; P0CK45:E5 (xeno); NbExp=2; IntAct=EBI-721179, EBI-7015490;
Ptm Ubiquitinated by RNF182, leading to its degradation via the ubiquitin-proteasome pathway.
Similarity Belongs to the V-ATPase proteolipid subunit family.
Subcellular Location Vacuole membrane; Multi-pass membrane protein.
Subunit V-ATPase is a heteromultimeric enzyme composed of a peripheral catalytic V1 complex (main components: subunits A, B, C, D, E, and F) attached to an integral membrane V0 proton pore complex (main component: the proteolipid protein; which is present as a hexamer that forms the proton-conducting pore). Interacts with LASS2. Interacts with HTLV-1 accessory protein p12I. Interacts with RNF182; this interaction leads to ubiquitination and degradation via the proteasome pathway. {ECO

Identical and Related Proteins

Unique RefSeq proteins for LMP004875 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
310832382 RefSeq NP_001185498 155 V-type proton ATPase 16 kDa proteolipid subunit

Identical Sequences to LMP004875 proteins

Reference Database Accession Length Protein Name
GI:310832382 DBBJ BAG72935.1 155 ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c, partial [synthetic construct]
GI:310832382 GenBank AAX32777.1 155 ATPase lysosomal V0 subunit c [synthetic construct]
GI:310832382 GenBank ADZ15776.1 155 ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c, partial [synthetic construct]
GI:310832382 GenBank ADZ15795.1 155 ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c, partial [synthetic construct]
GI:310832382 GenBank AIC48332.1 155 ATP6V0C, partial [synthetic construct]
GI:310832382 GenBank AIC62947.1 155 ATP6V0C, partial [synthetic construct]

Related Sequences to LMP004875 proteins

Reference Database Accession Length Protein Name
GI:310832382 GenBank AAP36127.1 156 Homo sapiens ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c, partial [synthetic construct]
GI:310832382 GenBank AAX29388.1 156 ATPase H+ transporting lysosomal 16kDa V0 subunit c, partial [synthetic construct]
GI:310832382 GenBank JAA08138.1 155 ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c [Pan troglodytes]
GI:310832382 RefSeq XP_510748.3 155 PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Pan troglodytes]
GI:310832382 RefSeq XP_004057064.1 155 PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit isoform 2 [Gorilla gorilla gorilla]
GI:310832382 RefSeq XP_004057065.1 155 PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit isoform 3 [Gorilla gorilla gorilla]