Gene/Proteome Database (LMPD)
LMPD ID
LMP004886
Gene ID
Species
Mus musculus (Mouse)
Gene Name
Rab geranylgeranyl transferase, b subunit
Gene Symbol
Synonyms
-
Alternate Names
geranylgeranyl transferase type-2 subunit beta; GGTase-II-beta; rab GGTase beta; rab GG transferase beta; RAB geranylgeranyltransferase, beta subunit; rab geranyl-geranyltransferase subunit beta; geranylgeranyl transferase type II subunit beta; type II protein geranyl-geranyltransferase subunit beta
Chromosome
3
Map Location
3 H3|3 78.76 cM
EC Number
2.5.1.60
Proteins
| geranylgeranyl transferase type-2 subunit beta isoform 1 | |
|---|---|
| Refseq ID | NP_035361 |
| Protein GI | 254553291 |
| UniProt ID | P53612 |
| mRNA ID | NM_011231 |
| Length | 339 |
| RefSeq Status | VALIDATED |
| MGSLLFSWKGTQQKDVTIKSDAPDTLLLEKHADYIASYGSKKDDYEYCMSEYLRMSGVYWGLTVMDLMGQLHRMNREEILVFIKSCQHECGGISASIGHDPHLLYTLSAVQILTLYDSVHVINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVSPVFCMPEEVLQRVNVQPELVS | |
| geranylgeranyl transferase type-2 subunit beta isoform 2 | |
|---|---|
| Refseq ID | NP_001156950 |
| Protein GI | 254553293 |
| UniProt ID | Q3TVF4 |
| mRNA ID | NM_001163478 |
| Length | 331 |
| RefSeq Status | VALIDATED |
| MGTQQKDVTIKSDAPDTLLLEKHADYIASYGSKKDDYEYCMSEYLRMSGVYWGLTVMDLMGQLHRMNREEILVFIKSCQHECGGISASIGHDPHLLYTLSAVQILTLYDSVHVINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVSPVFCMPEEVLQRVNVQPELVS | |
| geranylgeranyl transferase type-2 subunit beta isoform 3 | |
|---|---|
| Refseq ID | NP_001156951 |
| Protein GI | 254553295 |
| UniProt ID | Q3TVF4 |
| mRNA ID | NM_001163479 |
| Length | 291 |
| RefSeq Status | VALIDATED |
| MSEYLRMSGVYWGLTVMDLMGQLHRMNREEILVFIKSCQHECGGISASIGHDPHLLYTLSAVQILTLYDSVHVINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVSPVFCMPEEVLQRVNVQPELVS | |
Gene Information
Entrez Gene ID
Gene Name
Rab geranylgeranyl transferase, b subunit
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005968 | ISS:UniProtKB | C | Rab-protein geranylgeranyltransferase complex |
| GO:0017137 | ISS:UniProtKB | F | Rab GTPase binding |
| GO:0004663 | ISS:UniProtKB | F | Rab geranylgeranyltransferase activity |
| GO:0008270 | ISS:UniProtKB | F | zinc ion binding |
| GO:0018344 | ISS:UniProtKB | P | protein geranylgeranylation |
Domain Information
UniProt Annotations
Entry Information
Gene Name
Rab geranylgeranyl transferase, b subunit
Protein Entry
Q3TVF4_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Geranylgeranyl diphosphate + protein-cysteine = S-geranylgeranyl-protein + diphosphate. {ECO:0000269|PubMed:21520375}. |
| Cofactor | Name=Zn(2+); Xref=ChEBI:CHEBI:29105; Evidence={ECO:0000269|PubMed:21520375}; Note=Binds 1 zinc ion per subunit. {ECO:0000269|PubMed:21520375}; |
| Developmental Stage | Specific expression was elevated in mid- gestation stages, particularly developing liver and spinal cord. {ECO:0000269|PubMed:9031634}. |
| Enzyme Regulation | The enzymatic reaction requires the aid of a Rab escort protein (also called component A), such as CHM. |
| Function | Catalyzes the transfer of a geranylgeranyl moiety from geranylgeranyl diphosphate to both cysteines of Rab proteins with the C-terminal sequence -XXCC, -XCXC and -CCXX, such as RAB1A, RAB3A, RAB5A and RAB7A. {ECO:0000269|PubMed:21520375}. |
| Induction | Increased dramatically by cycloheximide (CHX) treatment within a short time (as early as 2 hours). Actinomycin D was used to determine the half-life, CHX treatment resulted in a dramatic increase of the half-life from 8 hours to greater than 12 hours. {ECO:0000269|PubMed:9031634}. |
| Similarity | Belongs to the protein prenyltransferase subunit beta family. {ECO:0000305}. |
| Similarity | Contains 6 PFTB repeats. {ECO:0000305}. |
| Subunit | Heterotrimer composed of RABGGTA, RABGGTB and CHM; within this trimer, RABGGTA and RABGGTB form the catalytic component B, while CHM (component A) mediates peptide substrate binding. The Rab GGTase dimer (RGGT) interacts with CHM (component A) prior to Rab protein binding; the association is stabilized by geranylgeranyl pyrophosphate (GGpp). The CHM:RGGT:Rab complex is destabilized by GGpp. Interaction of RABGGTB with prenylated PTP4A2 precludes its association with RABGGTA and inhibits enzyme activity (By similarity). {ECO:0000250}. |
| Tissue Specificity | Ubiquitous. Detected in all the major organs in adult animals. {ECO:0000269|PubMed:9031634}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP004886 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 254553291 | RefSeq | NP_035361 | 339 | geranylgeranyl transferase type-2 subunit beta isoform 1 |
| 254553293 | RefSeq | NP_001156950 | 331 | geranylgeranyl transferase type-2 subunit beta isoform 2 |
| 254553295 | RefSeq | NP_001156951 | 291 | geranylgeranyl transferase type-2 subunit beta isoform 3 |
Identical Sequences to LMP004886 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:254553293 | DBBJ | BAE35665.1 | 331 | unnamed protein product [Mus musculus] |
| GI:254553291 | GenBank | AAI32474.1 | 339 | RAB geranylgeranyl transferase, b subunit [Mus musculus] |
| GI:254553293 | GenBank | EDL11897.1 | 331 | RAB geranylgeranyl transferase, b subunit, isoform CRA_a [Mus musculus] |
| GI:254553295 | GenBank | EDL11898.1 | 291 | RAB geranylgeranyl transferase, b subunit, isoform CRA_b [Mus musculus] |
| GI:254553295 | GenBank | EDL11899.1 | 291 | RAB geranylgeranyl transferase, b subunit, isoform CRA_b [Mus musculus] |
| GI:254553291 | GenBank | EDL11902.1 | 339 | RAB geranylgeranyl transferase, b subunit, isoform CRA_e [Mus musculus] |
| GI:254553291 | GenBank | AAI38548.1 | 339 | RAB geranylgeranyl transferase, b subunit [Mus musculus] |
| GI:254553291 | GenBank | AED45665.1 | 339 | Sequence 1815 from patent US 7892730 |
| GI:254553291 | SwissProt | P53612.2 | 339 | RecName: Full=Geranylgeranyl transferase type-2 subunit beta; AltName: Full=Geranylgeranyl transferase type II subunit beta; Short=GGTase-II-beta; AltName: Full=Rab geranyl-geranyltransferase subunit beta; Short=Rab GG transferase beta; Short=Rab GGTase beta; AltName: Full=Rab geranylgeranyltransferase subunit beta; AltName: Full=Type II protein geranyl-geranyltransferase subunit beta [Mus musculus] |
Related Sequences to LMP004886 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:254553291 | DBBJ | BAE35665.1 | 331 | unnamed protein product [Mus musculus] |
| GI:254553291 | GenBank | AAB01502.1 | 339 | geranylgeranyl transferase beta subunit [Mus musculus] |
| GI:254553293 | GenBank | AAI32474.1 | 339 | RAB geranylgeranyl transferase, b subunit [Mus musculus] |
| GI:254553295 | GenBank | AAI32474.1 | 339 | RAB geranylgeranyl transferase, b subunit [Mus musculus] |
| GI:254553291 | GenBank | EDL11897.1 | 331 | RAB geranylgeranyl transferase, b subunit, isoform CRA_a [Mus musculus] |
| GI:254553295 | GenBank | EDL11902.1 | 339 | RAB geranylgeranyl transferase, b subunit, isoform CRA_e [Mus musculus] |
| GI:254553293 | GenBank | EDL11902.1 | 339 | RAB geranylgeranyl transferase, b subunit, isoform CRA_e [Mus musculus] |
| GI:254553293 | GenBank | AAI38548.1 | 339 | RAB geranylgeranyl transferase, b subunit [Mus musculus] |
| GI:254553295 | GenBank | AAI38548.1 | 339 | RAB geranylgeranyl transferase, b subunit [Mus musculus] |
| GI:254553295 | GenBank | AED45665.1 | 339 | Sequence 1815 from patent US 7892730 |
| GI:254553293 | GenBank | AED45665.1 | 339 | Sequence 1815 from patent US 7892730 |
| GI:254553291 | PDB | 3HXC | 331 | Chain B, Engineered Rabggtase In Complex With A Peptidomimetic Inhibitor (compound 8) |
| GI:254553291 | PDB | 3HXD | 331 | Chain B, Engineered Rabggtase In Complex With A Peptidomimetic Inhibitor (Compound 9) |
| GI:254553293 | RefSeq | NP_035361.2 | 339 | geranylgeranyl transferase type-2 subunit beta isoform 1 [Mus musculus] |
| GI:254553295 | RefSeq | NP_035361.2 | 339 | geranylgeranyl transferase type-2 subunit beta isoform 1 [Mus musculus] |
| GI:254553291 | RefSeq | NP_001156950.1 | 331 | geranylgeranyl transferase type-2 subunit beta isoform 2 [Mus musculus] |
| GI:254553295 | SwissProt | P53612.2 | 339 | RecName: Full=Geranylgeranyl transferase type-2 subunit beta; AltName: Full=Geranylgeranyl transferase type II subunit beta; Short=GGTase-II-beta; AltName: Full=Rab geranyl-geranyltransferase subunit beta; Short=Rab GG transferase beta; Short=Rab GGTase beta; AltName: Full=Rab geranylgeranyltransferase subunit beta; AltName: Full=Type II protein geranyl-geranyltransferase subunit beta [Mus musculus] |
| GI:254553293 | SwissProt | P53612.2 | 339 | RecName: Full=Geranylgeranyl transferase type-2 subunit beta; AltName: Full=Geranylgeranyl transferase type II subunit beta; Short=GGTase-II-beta; AltName: Full=Rab geranyl-geranyltransferase subunit beta; Short=Rab GG transferase beta; Short=Rab GGTase beta; AltName: Full=Rab geranylgeranyltransferase subunit beta; AltName: Full=Type II protein geranyl-geranyltransferase subunit beta [Mus musculus] |