Gene/Proteome Database (LMPD)

LMPD ID
LMP004886
Gene ID
19352
Species
Mus musculus (Mouse)
Gene Name
Rab geranylgeranyl transferase, b subunit
Gene Symbol
Rabggtb
Synonyms
-
Alternate Names
geranylgeranyl transferase type-2 subunit beta; GGTase-II-beta; rab GGTase beta; rab GG transferase beta; RAB geranylgeranyltransferase, beta subunit; rab geranyl-geranyltransferase subunit beta; geranylgeranyl transferase type II subunit beta; type II protein geranyl-geranyltransferase subunit beta
Chromosome
3
Map Location
3 H3|3 78.76 cM
EC Number
2.5.1.60

Proteins

geranylgeranyl transferase type-2 subunit beta isoform 1
Refseq ID NP_035361
Protein GI 254553291
UniProt ID P53612
mRNA ID NM_011231
Length 339
RefSeq Status VALIDATED
MGSLLFSWKGTQQKDVTIKSDAPDTLLLEKHADYIASYGSKKDDYEYCMSEYLRMSGVYWGLTVMDLMGQLHRMNREEILVFIKSCQHECGGISASIGHDPHLLYTLSAVQILTLYDSVHVINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVSPVFCMPEEVLQRVNVQPELVS
geranylgeranyl transferase type-2 subunit beta isoform 2
Refseq ID NP_001156950
Protein GI 254553293
UniProt ID Q3TVF4
mRNA ID NM_001163478
Length 331
RefSeq Status VALIDATED
MGTQQKDVTIKSDAPDTLLLEKHADYIASYGSKKDDYEYCMSEYLRMSGVYWGLTVMDLMGQLHRMNREEILVFIKSCQHECGGISASIGHDPHLLYTLSAVQILTLYDSVHVINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVSPVFCMPEEVLQRVNVQPELVS
geranylgeranyl transferase type-2 subunit beta isoform 3
Refseq ID NP_001156951
Protein GI 254553295
UniProt ID Q3TVF4
mRNA ID NM_001163479
Length 291
RefSeq Status VALIDATED
MSEYLRMSGVYWGLTVMDLMGQLHRMNREEILVFIKSCQHECGGISASIGHDPHLLYTLSAVQILTLYDSVHVINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVSPVFCMPEEVLQRVNVQPELVS

Gene Information

Entrez Gene ID
19352
Gene Name
Rab geranylgeranyl transferase, b subunit
Gene Symbol
Rabggtb
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005968 ISS:UniProtKB C Rab-protein geranylgeranyltransferase complex
GO:0004663 ISS:UniProtKB F Rab geranylgeranyltransferase activity
GO:0017137 ISS:UniProtKB F Rab GTPase binding
GO:0008270 ISS:UniProtKB F zinc ion binding
GO:0018344 ISS:UniProtKB P protein geranylgeranylation

Domain Information

InterPro Annotations

Accession Description
IPR026873 Geranylgeranyl transferase type-2 subunit beta
IPR001330 Prenyltransferase/squalene oxidase
IPR008930 Terpenoid cyclases/protein prenyltransferase alpha-alpha toroid

UniProt Annotations

Entry Information

Gene Name
Rab geranylgeranyl transferase, b subunit
Protein Entry
Q3TVF4_MOUSE
UniProt ID
Q3TVF4
Species
Mouse

Comments

Comment Type Description
Catalytic Activity Geranylgeranyl diphosphate + protein-cysteine = S-geranylgeranyl-protein + diphosphate. {ECO:0000269|PubMed:21520375}.
Cofactor Name=Zn(2+); Xref=ChEBI:CHEBI:29105; Evidence={ECO:0000269|PubMed:21520375}; Note=Binds 1 zinc ion per subunit. {ECO:0000269|PubMed:21520375};
Developmental Stage Specific expression was elevated in mid- gestation stages, particularly developing liver and spinal cord. {ECO:0000269|PubMed:9031634}.
Enzyme Regulation The enzymatic reaction requires the aid of a Rab escort protein (also called component A), such as CHM.
Function Catalyzes the transfer of a geranylgeranyl moiety from geranylgeranyl diphosphate to both cysteines of Rab proteins with the C-terminal sequence -XXCC, -XCXC and -CCXX, such as RAB1A, RAB3A, RAB5A and RAB7A. {ECO:0000269|PubMed:21520375}.
Induction Increased dramatically by cycloheximide (CHX) treatment within a short time (as early as 2 hours). Actinomycin D was used to determine the half-life, CHX treatment resulted in a dramatic increase of the half-life from 8 hours to greater than 12 hours. {ECO:0000269|PubMed:9031634}.
Similarity Belongs to the protein prenyltransferase subunit beta family. {ECO:0000305}.
Similarity Contains 6 PFTB repeats. {ECO:0000305}.
Subunit Heterotrimer composed of RABGGTA, RABGGTB and CHM; within this trimer, RABGGTA and RABGGTB form the catalytic component B, while CHM (component A) mediates peptide substrate binding. The Rab GGTase dimer (RGGT) interacts with CHM (component A) prior to Rab protein binding; the association is stabilized by geranylgeranyl pyrophosphate (GGpp). The CHM:RGGT:Rab complex is destabilized by GGpp. Interaction of RABGGTB with prenylated PTP4A2 precludes its association with RABGGTA and inhibits enzyme activity (By similarity). {ECO:0000250}.
Tissue Specificity Ubiquitous. Detected in all the major organs in adult animals. {ECO:0000269|PubMed:9031634}.

Identical and Related Proteins

Unique RefSeq proteins for LMP004886 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
254553291 RefSeq NP_035361 339 geranylgeranyl transferase type-2 subunit beta isoform 1
254553293 RefSeq NP_001156950 331 geranylgeranyl transferase type-2 subunit beta isoform 2
254553295 RefSeq NP_001156951 291 geranylgeranyl transferase type-2 subunit beta isoform 3

Identical Sequences to LMP004886 proteins

Reference Database Accession Length Protein Name
GI:254553293 DBBJ BAE35665.1 331 unnamed protein product [Mus musculus]
GI:254553291 GenBank AAI32474.1 339 RAB geranylgeranyl transferase, b subunit [Mus musculus]
GI:254553293 GenBank EDL11897.1 331 RAB geranylgeranyl transferase, b subunit, isoform CRA_a [Mus musculus]
GI:254553295 GenBank EDL11898.1 291 RAB geranylgeranyl transferase, b subunit, isoform CRA_b [Mus musculus]
GI:254553295 GenBank EDL11899.1 291 RAB geranylgeranyl transferase, b subunit, isoform CRA_b [Mus musculus]
GI:254553291 GenBank EDL11902.1 339 RAB geranylgeranyl transferase, b subunit, isoform CRA_e [Mus musculus]
GI:254553291 GenBank AAI38548.1 339 RAB geranylgeranyl transferase, b subunit [Mus musculus]
GI:254553291 GenBank AED45665.1 339 Sequence 1815 from patent US 7892730
GI:254553291 SwissProt P53612.2 339 RecName: Full=Geranylgeranyl transferase type-2 subunit beta; AltName: Full=Geranylgeranyl transferase type II subunit beta; Short=GGTase-II-beta; AltName: Full=Rab geranyl-geranyltransferase subunit beta; Short=Rab GG transferase beta; Short=Rab GGTase beta; AltName: Full=Rab geranylgeranyltransferase subunit beta; AltName: Full=Type II protein geranyl-geranyltransferase subunit beta [Mus musculus]

Related Sequences to LMP004886 proteins

Reference Database Accession Length Protein Name
GI:254553291 DBBJ BAE35665.1 331 unnamed protein product [Mus musculus]
GI:254553291 GenBank AAB01502.1 339 geranylgeranyl transferase beta subunit [Mus musculus]
GI:254553295 GenBank AAI32474.1 339 RAB geranylgeranyl transferase, b subunit [Mus musculus]
GI:254553293 GenBank AAI32474.1 339 RAB geranylgeranyl transferase, b subunit [Mus musculus]
GI:254553291 GenBank EDL11897.1 331 RAB geranylgeranyl transferase, b subunit, isoform CRA_a [Mus musculus]
GI:254553295 GenBank EDL11902.1 339 RAB geranylgeranyl transferase, b subunit, isoform CRA_e [Mus musculus]
GI:254553293 GenBank EDL11902.1 339 RAB geranylgeranyl transferase, b subunit, isoform CRA_e [Mus musculus]
GI:254553293 GenBank AAI38548.1 339 RAB geranylgeranyl transferase, b subunit [Mus musculus]
GI:254553295 GenBank AAI38548.1 339 RAB geranylgeranyl transferase, b subunit [Mus musculus]
GI:254553295 GenBank AED45665.1 339 Sequence 1815 from patent US 7892730
GI:254553293 GenBank AED45665.1 339 Sequence 1815 from patent US 7892730
GI:254553291 PDB 3HXC 331 Chain B, Engineered Rabggtase In Complex With A Peptidomimetic Inhibitor (compound 8)
GI:254553291 PDB 3HXD 331 Chain B, Engineered Rabggtase In Complex With A Peptidomimetic Inhibitor (Compound 9)
GI:254553295 RefSeq NP_035361.2 339 geranylgeranyl transferase type-2 subunit beta isoform 1 [Mus musculus]
GI:254553293 RefSeq NP_035361.2 339 geranylgeranyl transferase type-2 subunit beta isoform 1 [Mus musculus]
GI:254553291 RefSeq NP_001156950.1 331 geranylgeranyl transferase type-2 subunit beta isoform 2 [Mus musculus]
GI:254553293 SwissProt P53612.2 339 RecName: Full=Geranylgeranyl transferase type-2 subunit beta; AltName: Full=Geranylgeranyl transferase type II subunit beta; Short=GGTase-II-beta; AltName: Full=Rab geranyl-geranyltransferase subunit beta; Short=Rab GG transferase beta; Short=Rab GGTase beta; AltName: Full=Rab geranylgeranyltransferase subunit beta; AltName: Full=Type II protein geranyl-geranyltransferase subunit beta [Mus musculus]
GI:254553295 SwissProt P53612.2 339 RecName: Full=Geranylgeranyl transferase type-2 subunit beta; AltName: Full=Geranylgeranyl transferase type II subunit beta; Short=GGTase-II-beta; AltName: Full=Rab geranyl-geranyltransferase subunit beta; Short=Rab GG transferase beta; Short=Rab GGTase beta; AltName: Full=Rab geranylgeranyltransferase subunit beta; AltName: Full=Type II protein geranyl-geranyltransferase subunit beta [Mus musculus]