Gene/Proteome Database (LMPD)
LMPD ID
LMP004923
Gene ID
Species
Mus musculus (Mouse)
Gene Name
steroid 5 alpha-reductase 3
Gene Symbol
Synonyms
1110025P14Rik; A430076C09; AV364670; AW987574; D730040M03Rik; H5ar; S5AR 3; Srd5a2l
Alternate Names
polyprenol reductase; H5AR; SR type 3; steroid 5-alpha-reductase 3; probable polyprenol reductase; steroid 5 alpha-reductase 2 like; 3-oxo-5-alpha-steroid 4-dehydrogenase 3; steroid 5 alpha-reductase 2-like; H5AR gene; steroid 5 alpha-reductase 2 like
Chromosome
5
Map Location
5 C3.3|5
EC Number
1.3.1.94
Proteins
| polyprenol reductase | |
|---|---|
| Refseq ID | NP_065636 |
| Protein GI | 27881427 |
| UniProt ID | Q9WUP4 |
| mRNA ID | NM_020611 |
| Length | 330 |
| RefSeq Status | VALIDATED |
| MAGWAGFELSALNPLRTLWLALAAAFLFALLLQLAPARLLPSCALFQDLLRYGKTKQSGSRRPAVCRAFDVPKRYFSHFYVISVVWNGSLLWLLSQSLFLGAPFPNWLSALLRTLGATQFQALEMESKASRMPAAELALSAFLVLVFLWVHSLRRLFECFYVSVFSNAAIHVVQYCFGLVYYVLVGLTVLSQVPMDDKNVYVLGKNLLIQARWFHILGMVMFFWSSAHQYKCHVILSNLRRNKKGVVIHCQHRIPFGDWFEYVSSANYLAELMIYISMAVTFGLHNLTWWLVVTYVFSSQALSAFFNHKFYRSTFVSYPKHRKAFLPFLF | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | ISS:UniProtKB | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0003865 | ISS:UniProtKB | F | 3-oxo-5-alpha-steroid 4-dehydrogenase activity |
| GO:0047751 | IEA:UniProtKB-EC | F | cholestenone 5-alpha-reductase activity |
| GO:0016628 | ISS:UniProtKB | F | oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor |
| GO:0019348 | IMP:UniProtKB | P | dolichol metabolic process |
| GO:0006488 | IMP:UniProtKB | P | dolichol-linked oligosaccharide biosynthetic process |
| GO:0016095 | IMP:UniProtKB | P | polyprenol catabolic process |
| GO:0006486 | IEA:UniProtKB-UniPathway | P | protein glycosylation |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko00140 | Steroid hormone biosynthesis |
| mmu00140 | Steroid hormone biosynthesis |
REACTOME Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001104 | 3-oxo-5-alpha-steroid 4-dehydrogenase, C-terminal |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9WUP4-1; Sequence=Displayed; Name=2; IsoId=Q9WUP4-2; Sequence=VSP_039779; Note=No experimental confirmation available.; |
| Catalytic Activity | A 3-oxo-5-alpha-steroid + NADP(+) = a 3-oxo- Delta(4)-steroid + NADPH. |
| Catalytic Activity | Ditrans,polycis-dolichol + NADP(+) = ditrans,polycis-polyprenol + NADPH. |
| Disruption Phenotype | Death by E12.5. At E10.5, embryos are smaller and fail to undergo axial rotation observed at E8.5 in wild-types and present dilated hearts and open neural tubes. {ECO:0000269|PubMed:20637498}. |
| Function | Plays a key role in early steps of protein N-linked glycosylation by being required for the conversion of polyprenol into dolichol. Dolichols are required for the synthesis of dolichol-linked monosaccharides and the oligosaccharide precursor used for N-glycosylation. Acts as a polyprenol reductase that promotes the reduction of the alpha-isoprene unit of polyprenols into dolichols in a NADP-dependent mechanism. Also able to convert testosterone (T) into 5-alpha-dihydrotestosterone (DHT). {ECO:0000269|PubMed:20637498}. |
| Pathway | Protein modification; protein glycosylation. {ECO:0000269|PubMed:20637498}. |
| Similarity | Belongs to the steroid 5-alpha reductase family. Polyprenol reductase subfamily. {ECO:0000305}. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP004923 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 27881427 | RefSeq | NP_065636 | 330 | polyprenol reductase |
Identical Sequences to LMP004923 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:27881427 | DBBJ | BAC30537.1 | 330 | unnamed protein product [Mus musculus] |
| GI:27881427 | DBBJ | BAC35871.1 | 330 | unnamed protein product [Mus musculus] |
| GI:27881427 | DBBJ | BAE36955.1 | 330 | unnamed protein product [Mus musculus] |
| GI:27881427 | DBBJ | BAE23944.1 | 330 | unnamed protein product [Mus musculus] |
| GI:27881427 | SwissProt | Q9WUP4.2 | 330 | RecName: Full=Polyprenol reductase; AltName: Full=3-oxo-5-alpha-steroid 4-dehydrogenase 3; AltName: Full=Steroid 5-alpha-reductase 2-like; AltName: Full=Steroid 5-alpha-reductase 3; Short=S5AR 3; Short=SR type 3 [Mus musculus] |
Related Sequences to LMP004923 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:27881427 | GenBank | AAD30567.1 | 330 | SRD5A2L [Mus musculus] |
| GI:27881427 | GenBank | AAQ38211.1 | 330 | Sequence 144 from patent US 6573095 |
| GI:27881427 | GenBank | AAQ38268.1 | 330 | Sequence 278 from patent US 6573095 |
| GI:27881427 | GenBank | EDL37892.1 | 330 | steroid 5 alpha-reductase 2-like, isoform CRA_a [Mus musculus] |
| GI:27881427 | GenBank | AAI45648.1 | 330 | Srd5a3 protein [Mus musculus] |
| GI:27881427 | RefSeq | XP_006250959.1 | 330 | PREDICTED: polyprenol reductase isoform X1 [Rattus norvegicus] |