Gene/Proteome Database (LMPD)
LMPD ID
LMP004948
Gene ID
Species
Homo sapiens (Human)
Gene Name
fucosyltransferase 9 (alpha (1,3) fucosyltransferase)
Gene Symbol
Synonyms
Fuc-TIX
Alternate Names
alpha-(1,3)-fucosyltransferase 9; fucT-IX; fucosyltransferase IX; galactoside 3-L-fucosyltransferase
Chromosome
6
Map Location
6q16
EC Number
2.4.1.-
Summary
The protein encoded by this gene belongs to the glycosyltransferase family. It is localized to the golgi, and catalyzes the last step in the biosynthesis of Lewis X (LeX) antigen, the addition of a fucose to precursor polysaccharides. This protein is one of the few fucosyltransferases that synthesizes the LeX oligosaccharide (CD15) expressed in the organ buds progressing in mesenchyma during embryogenesis. It is also responsible for the expression of CD15 in mature granulocytes. A common haplotype of this gene has also been associated with susceptibility to placental malaria infection. [provided by RefSeq, Nov 2011]
Orthologs
Proteins
| alpha-(1,3)-fucosyltransferase 9 | |
|---|---|
| Refseq ID | NP_006572 |
| Protein GI | 139394626 |
| UniProt ID | Q9Y231 |
| mRNA ID | NM_006581 |
| Length | 359 |
| RefSeq Status | REVIEWED |
| MTSTSKGILRPFLIVCIILGCFMACLLIYIKPTNSWIFSPMESASSVLKMKNFFSTKTDYFNETTILVWVWPFGQTFDLTSCQAMFNIQGCHLTTDRSLYNKSHAVLIHHRDISWDLTNLPQQARPPFQKWIWMNLESPTHTPQKSGIEHLFNLTLTYRRDSDIQVPYGFLTVSTNPFVFEVPSKEKLVCWVVSNWNPEHARVKYYNELSKSIEIHTYGQAFGEYVNDKNLIPTISTCKFYLSFENSIHKDYITEKLYNAFLAGSVPVVLGPSRENYENYIPADSFIHVEDYNSPSELAKYLKEVDKNNKLYLSYFNWRKDFTVNLPRFWESHACLACDHVKRHQEYKSVGNLEKWFWN | |
Gene Information
Entrez Gene ID
Gene Name
fucosyltransferase 9 (alpha (1,3) fucosyltransferase)
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005794 | TAS:UniProtKB | C | Golgi apparatus |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0046920 | TAS:UniProtKB | F | alpha-(1->3)-fucosyltransferase activity |
| GO:0008417 | TAS:ProtInc | F | fucosyltransferase activity |
| GO:0042355 | NAS:UniProtKB | P | L-fucose catabolic process |
| GO:0005975 | TAS:ProtInc | P | carbohydrate metabolic process |
| GO:0036065 | TAS:GOC | P | fucosylation |
| GO:0007399 | IEA:Ensembl | P | nervous system development |
| GO:0006486 | TAS:UniProtKB | P | protein glycosylation |
KEGG Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001503 | Glycosyl transferase, family 10 |
UniProt Annotations
Entry Information
Gene Name
fucosyltransferase 9 (alpha (1,3) fucosyltransferase)
Protein Entry
FUT9_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Function | Transfers a fucose to lacto-N-neotetraose but not to either alpha2,3-sialyl lacto-N-neotetraose or lacto-N-tetraose. Can catalyze the last step in the biosynthesis of Lewis antigen, the addition of a fucose to precursor polysaccharides. |
| Pathway | Protein modification; protein glycosylation. |
| Similarity | Belongs to the glycosyltransferase 10 family. |
| Subcellular Location | Golgi apparatus, Golgi stack membrane {ECO |
| Tissue Specificity | Strongly expressed in forebrain and stomach, lower expression in spleen and peripheral blood leukocytes, and no expression in small intestine, colon, liver, lung, kidney, adrenal cortex or uterus. |
| Web Resource | Name=Functional Glycomics Gateway - GTase; Note=Fucosyltransferase 9; URL="http://www.functionalglycomics.org/glycomics/molecule/jsp/glycoEnzyme/viewGlycoEnzyme.jsp?gbpId=gt_hum_606"; |
| Web Resource | Name=GGDB; Note=GlycoGene database; URL="http://jcggdb.jp/rcmg/ggdb/Homolog?cat=symbol&symbol=FUT9"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP004948 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 139394626 | RefSeq | NP_006572 | 359 | alpha-(1,3)-fucosyltransferase 9 |
Identical Sequences to LMP004948 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:139394626 | RefSeq | XP_009203952.1 | 359 | PREDICTED: alpha-(1,3)-fucosyltransferase 9 [Papio anubis] |
| GI:139394626 | RefSeq | XP_009240370.1 | 359 | PREDICTED: alpha-(1,3)-fucosyltransferase 9 [Pongo abelii] |
| GI:139394626 | RefSeq | XP_009449941.1 | 359 | PREDICTED: alpha-(1,3)-fucosyltransferase 9 isoform X1 [Pan troglodytes] |
| GI:139394626 | RefSeq | XP_009449942.1 | 359 | PREDICTED: alpha-(1,3)-fucosyltransferase 9 isoform X1 [Pan troglodytes] |
| GI:139394626 | RefSeq | XP_010357520.1 | 359 | PREDICTED: alpha-(1,3)-fucosyltransferase 9 [Rhinopithecus roxellana] |
| GI:139394626 | RefSeq | XP_010332077.1 | 359 | PREDICTED: alpha-(1,3)-fucosyltransferase 9 [Saimiri boliviensis boliviensis] |
Related Sequences to LMP004948 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:139394626 | GenBank | ABM85049.1 | 359 | fucosyltransferase 9 (alpha (1,3) fucosyltransferase), partial [synthetic construct] |
| GI:139394626 | GenBank | ABW46652.1 | 359 | Sequence 2 from patent US 7262039 |
| GI:139394626 | GenBank | AFG79849.1 | 359 | Sequence 108 from patent US 8137928 |
| GI:139394626 | RefSeq | XP_003258396.1 | 359 | PREDICTED: alpha-(1,3)-fucosyltransferase [Nomascus leucogenys] |
| GI:139394626 | RefSeq | XP_004580430.1 | 359 | PREDICTED: alpha-(1,3)-fucosyltransferase-like [Ochotona princeps] |
| GI:139394626 | RefSeq | XP_008261450.1 | 359 | PREDICTED: alpha-(1,3)-fucosyltransferase 9 [Oryctolagus cuniculus] |