Gene/Proteome Database (LMPD)

LMPD ID
LMP005013
Gene ID
30805
Species
Mus musculus (Mouse)
Gene Name
solute carrier family 22 (organic cation transporter), member 4
Gene Symbol
Slc22a4
Synonyms
Octn1
Alternate Names
solute carrier family 22 member 4; LSTP-Like 2; organic cation transporter 1; organic cation/carnitine transporter 1; solute carrier family (organic cation transporter), member 4
Chromosome
11
Map Location
11 B1.3|11 32.07 cM

Proteins

solute carrier family 22 member 4
Refseq ID NP_062661
Protein GI 9790129
UniProt ID Q9Z306
mRNA ID NM_019687
Length 553
RefSeq Status PROVISIONAL
MRDYDEVIAFLGEWGPFQRLIFFLLSASIIPNGFNGMSVVFLAGTPEHRCLVPDTVNLSSSWRNHSIPLETKDGRQVPQSCRRYRLATIANFSAMGLEPGQDVDLEQLEQESCLDGWEYDKDIFLSTIVTEWNLVCEDDWKTPLTTSLFFVGVLCGSFVSGQLSDRFGRKKVLFATMAVQTGFSFVQIFSTNWEMFTVLFAIVGMGQISNYVVAFILGTEILSKSVRIIFSTLGVCTFFAIGYMVLPLFAYFIRDWRMLLLALTLPGLFCVPLWWFIPESPRWLISQRRFAEAEQIIQKAAKMNSIVAPAGIFDPLELQELNSLKQQKVIILDLFRTRNIATITVMAVMLWMLTSVGYFALSLNVPNLHGDVYLNCFLSGLIEVPAYFTAWLLLRTLPRRYIIAGVLFWGGGVLLLIQVVPEDYNFVSIGLVMLGKFGITSAFSMLYVFTAELYPTLVRNMAVGITSMASRVGSIIAPYFVYLGAYNRLLPYILMGSLTVLIGIITLFFPESFGVTLPENLEQMQKVRGFRCGKKSTVSVDREESPKVLITAF

Gene Information

Entrez Gene ID
30805
Gene Name
solute carrier family 22 (organic cation transporter), member 4
Gene Symbol
Slc22a4
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016324 IEA:Ensembl C apical plasma membrane
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005739 IDA:MGI C mitochondrion
GO:0005524 IEA:UniProtKB-KW F ATP binding
GO:0015226 IDA:MGI F carnitine transmembrane transporter activity
GO:0015491 IEA:Ensembl F cation:cation antiporter activity
GO:0015293 IEA:UniProtKB-KW F symporter activity
GO:0009437 IGI:MGI P carnitine metabolic process
GO:1902603 IDA:GOC P carnitine transmembrane transport
GO:0015879 IDA:MGI P carnitine transport
GO:0015697 IDA:MGI P quaternary ammonium group transport
GO:0006814 IEA:UniProtKB-KW P sodium ion transport
GO:0006641 IGI:MGI P triglyceride metabolic process

REACTOME Pathway Links

REACTOME Pathway ID Description
5893840 Organic cation transport
5893841 Organic cation/anion/zwitterion transport
5892774 SLC-mediated transmembrane transport
5893405 Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds

Domain Information

InterPro Annotations

Accession Description
IPR005828 General substrate transporter
IPR020846 Major facilitator superfamily domain
IPR004749 Organic cation transport protein
IPR005829 Sugar transporter, conserved site

UniProt Annotations

Entry Information

Gene Name
solute carrier family 22 (organic cation transporter), member 4
Protein Entry
S22A4_MOUSE
UniProt ID
Q9Z306
Species
Mouse

Comments

Comment Type Description
Caution It is unclear whether it transports carnitine in vivo. {ECO:0000305}.
Function Sodium-ion dependent, low affinity carnitine transporter. Probably transports one sodium ion with one molecule of carnitine. Also transports organic cations such as tetraethylammonium (TEA) without the involvement of sodium. Relative uptake activity ratio of carnitine to TEA is 1.78. {ECO:0000269|PubMed:11010964}.
Similarity Belongs to the major facilitator (TC 2.A.1) superfamily. Organic cation transporter (TC 2.A.1.19) family. {ECO:0000305}.
Subcellular Location Membrane {ECO:0000269|PubMed:11010964}; Multi-pass membrane protein {ECO:0000269|PubMed:11010964}.
Subunit Interacts with PDZK1. {ECO:0000269|PubMed:14531806}.
Tissue Specificity Expressed in kidney, liver and testis. Weakly expressed in other tissues. {ECO:0000269|PubMed:11010964}.

Identical and Related Proteins

Unique RefSeq proteins for LMP005013 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
9790129 RefSeq NP_062661 553 solute carrier family 22 member 4

Identical Sequences to LMP005013 proteins

Reference Database Accession Length Protein Name
GI:9790129 EMBL CAX30726.1 553 unnamed protein product [Mus musculus]
GI:9790129 GenBank AAH10590.1 553 Solute carrier family 22 (organic cation transporter), member 4 [Mus musculus]
GI:9790129 GenBank AAV24020.1 553 Sequence 22 from patent US 6759514
GI:9790129 GenBank EDL33555.1 553 mCG13777, isoform CRA_d [Mus musculus]
GI:9790129 GenBank AEH97781.1 553 Sequence 22 from patent US 7947470
GI:9790129 SwissProt Q9Z306.1 553 RecName: Full=Solute carrier family 22 member 4; AltName: Full=Organic cation/carnitine transporter 1 [Mus musculus]

Related Sequences to LMP005013 proteins

Reference Database Accession Length Protein Name
GI:9790129 GenBank AAD46922.1 553 organic cation transporter OCTN1 [Rattus norvegicus]
GI:9790129 GenBank EDM04414.1 553 rCG34891, isoform CRA_b [Rattus norvegicus]
GI:9790129 RefSeq NP_071606.1 553 solute carrier family 22 member 4 [Rattus norvegicus]
GI:9790129 RefSeq XP_006995964.1 553 PREDICTED: solute carrier family 22 member 4 [Peromyscus maniculatus bairdii]
GI:9790129 RefSeq XP_007623699.1 553 PREDICTED: solute carrier family 22 member 4 isoform X3 [Cricetulus griseus]
GI:9790129 SwissProt Q9R141.1 553 RecName: Full=Solute carrier family 22 member 4; AltName: Full=Organic cation/carnitine transporter 1 [Rattus norvegicus]