Gene/Proteome Database (LMPD)
LMPD ID
LMP005021
Gene ID
Species
Homo sapiens (Human)
Gene Name
zinc finger, DHHC-type containing 3
Gene Symbol
Synonyms
DHHC-3; GODZ; ZNF373
Alternate Names
palmitoyltransferase ZDHHC3; DHHC1 protein; zinc finger protein 373; zinc finger, DHHC domain containing 3; golgi-specific DHHC Zinc Finger Protein; zinc finger DHHC domain-containing protein 3; Golgi apparatus-specific protein with DHHC zinc finger domain
Chromosome
3
Map Location
3p21.31
EC Number
2.3.1.225
Proteins
palmitoyltransferase ZDHHC3 isoform 1 | |
---|---|
Refseq ID | NP_001128651 |
Protein GI | 206597477 |
UniProt ID | Q9NYG2 |
mRNA ID | NM_001135179 |
Length | 299 |
RefSeq Status | VALIDATED |
MMLIPTHHFRNIERKPEYLQPEKCVPPPYPGPVGTMWFIRDGCGIACAIVTWFLVLYAEFVVLFVMLIPSRDYVYSIINGIVFNLLAFLALASHCRAMLTDPGAVPKGNATKEFIESLQLKPGQVVYKCPKCCSIKPDRAHHCSVCKRCIRKMDHHCPWVNNCVGENNQKYFVLFTMYIALISLHALIMVGFHFLHCFEEDWTKCSSFSPPTTVILLILLCFEGLLFLIFTSVMFGTQVHSICTDETGIEQLKKEERRWAKKTKWMNMKAVFGHPFSLGWASPFATPDQGKADPYQYVV |
palmitoyltransferase ZDHHC3 isoform 2 | |
---|---|
Refseq ID | NP_057682 |
Protein GI | 7706133 |
UniProt ID | Q9NYG2 |
mRNA ID | NM_016598 |
Length | 327 |
RefSeq Status | VALIDATED |
MMLIPTHHFRNIERKPEYLQPEKCVPPPYPGPVGTMWFIRDGCGIACAIVTWFLVLYAEFVVLFVMLIPSRDYVYSIINGIVFNLLAFLALASHCRAMLTDPGAVPKGNATKEFIESLQLKPGQVVYKCPKCCSIKPDRAHHCSVCKRCIRKMDHHCPWVNNCVGENNQKYFVLFTMYIALISLHALIMVGFHFLHCFEEDWTTYGLNREEMAETGISLHEKMQPLNFSSTECSSFSPPTTVILLILLCFEGLLFLIFTSVMFGTQVHSICTDETGIEQLKKEERRWAKKTKWMNMKAVFGHPFSLGWASPFATPDQGKADPYQYVV |
Gene Information
Entrez Gene ID
Gene Name
zinc finger, DHHC-type containing 3
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005794 | IDA:UniProt | C | Golgi apparatus |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0016020 | IDA:UniProtKB | C | membrane |
GO:0016409 | IDA:UniProt | F | palmitoyltransferase activity |
GO:0019706 | IEA:UniProtKB-EC | F | protein-cysteine S-palmitoyltransferase activity |
GO:0008270 | IEA:InterPro | F | zinc ion binding |
GO:0018345 | IDA:UniProt | P | protein palmitoylation |
GO:0006605 | IEA:Ensembl | P | protein targeting |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR001594 | Zinc finger, DHHC-type, palmitoyltransferase |
UniProt Annotations
Entry Information
Gene Name
zinc finger, DHHC-type containing 3
Protein Entry
ZDHC3_HUMAN
UniProt ID
Species
Human
Comments
Comment Type | Description |
---|---|
Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9NYG2-1; Sequence=Displayed; Name=2; IsoId=Q9NYG2-2; Sequence=VSP_006934; |
Catalytic Activity | Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA. |
Domain | The DHHC domain is required for palmitoyltransferase activity. |
Function | Palmitoyltransferase with broad specificity. Palmitoylates GABA receptors on their gamma subunit (GABRG1, GABRG2 and GABRG3), which regulates synaptic clustering and/or cell surface stability. Palmitoylates glutamate receptors GRIA1 and GRIA2, which leads to their retention in Golgi (By similarity). |
Ptm | Autopalmitoylated. |
Similarity | Belongs to the DHHC palmitoyltransferase family. |
Similarity | Contains 1 DHHC-type zinc finger. |
Subcellular Location | Golgi apparatus membrane ; Multi-pass membrane protein . |
Identical and Related Proteins
Unique RefSeq proteins for LMP005021 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
206597477 | RefSeq | NP_001128651 | 299 | palmitoyltransferase ZDHHC3 isoform 1 |
7706133 | RefSeq | NP_057682 | 327 | palmitoyltransferase ZDHHC3 isoform 2 |
Identical Sequences to LMP005021 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:7706133 | GenBank | AAF63570.1 | 327 | DHHC1 protein [Homo sapiens] |
GI:7706133 | GenBank | EAW64730.1 | 327 | zinc finger, DHHC-type containing 3, isoform CRA_b [Homo sapiens] |
GI:206597477 | GenBank | JAA03900.1 | 299 | zinc finger, DHHC-type containing 3 [Pan troglodytes] |
GI:206597477 | GenBank | JAA18675.1 | 299 | zinc finger, DHHC-type containing 3 [Pan troglodytes] |
GI:206597477 | GenBank | JAA32488.1 | 299 | zinc finger, DHHC-type containing 3 [Pan troglodytes] |
GI:206597477 | GenBank | JAA36631.1 | 299 | zinc finger, DHHC-type containing 3 [Pan troglodytes] |
GI:7706133 | GenBank | AGJ46255.1 | 327 | Sequence 12 from patent US 8404655 |
GI:206597477 | RefSeq | XP_008959800.1 | 299 | PREDICTED: palmitoyltransferase ZDHHC3 isoform X8 [Pan paniscus] |
GI:206597477 | SwissProt | Q9NYG2.2 | 299 | RecName: Full=Palmitoyltransferase ZDHHC3; AltName: Full=Protein DHHC1; AltName: Full=Zinc finger DHHC domain-containing protein 3; Short=DHHC-3; AltName: Full=Zinc finger protein 373 [Homo sapiens] |
Related Sequences to LMP005021 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:7706133 | GenBank | JAA03901.1 | 327 | zinc finger, DHHC-type containing 3 [Pan troglodytes] |
GI:7706133 | GenBank | JAA18676.1 | 327 | zinc finger, DHHC-type containing 3 [Pan troglodytes] |
GI:7706133 | GenBank | JAA32489.1 | 327 | zinc finger, DHHC-type containing 3 [Pan troglodytes] |
GI:7706133 | GenBank | JAA36632.1 | 327 | zinc finger, DHHC-type containing 3 [Pan troglodytes] |
GI:7706133 | RefSeq | XP_516405.2 | 327 | PREDICTED: palmitoyltransferase ZDHHC3 isoform X7 [Pan troglodytes] |
GI:206597477 | RefSeq | XP_003257011.1 | 299 | PREDICTED: palmitoyltransferase ZDHHC3 isoform 1 [Nomascus leucogenys] |
GI:206597477 | RefSeq | XP_003776314.1 | 299 | PREDICTED: palmitoyltransferase ZDHHC3 isoform X4 [Pongo abelii] |
GI:206597477 | RefSeq | XP_003926290.1 | 299 | PREDICTED: palmitoyltransferase ZDHHC3 isoform X1 [Saimiri boliviensis boliviensis] |
GI:206597477 | RefSeq | XP_004034028.1 | 299 | PREDICTED: palmitoyltransferase ZDHHC3 isoform 1 [Gorilla gorilla gorilla] |
GI:206597477 | RefSeq | XP_007982108.1 | 299 | PREDICTED: palmitoyltransferase ZDHHC3 isoform X9 [Chlorocebus sabaeus] |
GI:7706133 | RefSeq | XP_008959799.1 | 327 | PREDICTED: palmitoyltransferase ZDHHC3 isoform X7 [Pan paniscus] |
GI:206597477 | RefSeq | XP_010372687.1 | 299 | PREDICTED: palmitoyltransferase ZDHHC3 isoform X2 [Rhinopithecus roxellana] |