Gene/Proteome Database (LMPD)

LMPD ID
LMP005074
Gene ID
Species
Mus musculus (Mouse)
Gene Name
dolichol-phosphate (beta-D) mannosyltransferase 2
Gene Symbol
Synonyms
AW557993; R75484
Chromosome
2
Map Location
2 B|2

Proteins

dolichol phosphate-mannose biosynthesis regulatory protein
Refseq ID NP_034203
Protein GI 6753672
UniProt ID Q545R7
mRNA ID NM_010073
Length 84
RefSeq Status VALIDATED
MATGTDQAVGFGLVAVSLIIFTYYTTWVILLPFIDSQHVIHKYFLPRAYAVLLPLAAGLLLLLFVGLFITYVMLKSQKITKKAQ

Gene Information

Entrez Gene ID
Gene Name
dolichol-phosphate (beta-D) mannosyltransferase 2
Gene Symbol
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0033185 ISO:MGI C dolichol-phosphate-mannose synthase complex
GO:0005783 ISO:MGI C endoplasmic reticulum
GO:0000506 IEA:Ensembl C glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex
GO:0030176 IEA:InterPro C integral component of endoplasmic reticulum membrane
GO:0016021 ISM:MGI C integral component of membrane
GO:0048471 IEA:Ensembl C perinuclear region of cytoplasm
GO:0004582 ISO:MGI F dolichyl-phosphate beta-D-mannosyltransferase activity
GO:0030234 IEA:Ensembl F enzyme regulator activity
GO:0006506 ISO:MGI P GPI anchor biosynthetic process
GO:0019348 ISO:MGI P dolichol metabolic process
GO:0031647 IEA:Ensembl P regulation of protein stability

Domain Information

InterPro Annotations

Accession Description
IPR009914 Dolichol phosphate-mannose biosynthesis regulatory

UniProt Annotations

Entry Information

Gene Name
dolichol-phosphate (beta-D) mannosyltransferase 2
Protein Entry
DPM2_MOUSE
UniProt ID
Species
Mouse

Identical and Related Proteins

Unique RefSeq proteins for LMP005074 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6753672 RefSeq NP_034203 84 dolichol phosphate-mannose biosynthesis regulatory protein

Identical Sequences to LMP005074 proteins

Reference Database Accession Length Protein Name
GI:6753672 DBBJ BAA33973.1 84 DPM2 [Mus musculus]
GI:6753672 DBBJ BAB22122.1 84 unnamed protein product [Mus musculus]
GI:6753672 DBBJ BAB23234.1 84 unnamed protein product [Mus musculus]
GI:6753672 GenBank AAH08256.1 84 Dolichol-phosphate (beta-D) mannosyltransferase 2 [Mus musculus]
GI:6753672 GenBank EDL08553.1 84 dolichol-phosphate (beta-D) mannosyltransferase 2 [Mus musculus]
GI:6753672 SwissProt Q9Z324.3 84 RecName: Full=Dolichol phosphate-mannose biosynthesis regulatory protein; AltName: Full=Dolichol-phosphate mannose synthase subunit 2; Short=DPM synthase subunit 2 [Mus musculus]

Related Sequences to LMP005074 proteins

Reference Database Accession Length Protein Name
GI:6753672 DBBJ BAA33972.1 84 DPM2 [Rattus norvegicus]
GI:6753672 GenBank AAD38194.1 84 DPM2 protein [Cricetulus griseus]
GI:6753672 RefSeq NP_062125.1 84 dolichol phosphate-mannose biosynthesis regulatory protein [Rattus norvegicus]
GI:6753672 RefSeq XP_006983544.1 84 PREDICTED: dolichol phosphate-mannose biosynthesis regulatory protein [Peromyscus maniculatus bairdii]
GI:6753672 SwissProt Q9Z325.3 84 RecName: Full=Dolichol phosphate-mannose biosynthesis regulatory protein; AltName: Full=Dolichol-phosphate mannose synthase subunit 2; Short=DPM synthase subunit 2 [Rattus norvegicus]
GI:6753672 SwissProt Q9Z1P1.3 84 RecName: Full=Dolichol phosphate-mannose biosynthesis regulatory protein; AltName: Full=Dolichol-phosphate mannose synthase subunit 2; Short=DPM synthase subunit 2 [Cricetulus griseus]