Gene/Proteome Database (LMPD)
LMPD ID
LMP005134
Gene ID
Species
Homo sapiens (Human)
Gene Name
phosphoserine aminotransferase 1
Gene Symbol
Synonyms
EPIP; NLS2; PSA; PSAT; PSATD
Alternate Names
phosphoserine aminotransferase; endometrial progesterone-induced protein; phosphohydroxythreonine aminotransferase
Chromosome
9
Map Location
9q21.2
EC Number
2.6.1.52
Summary
This gene encodes a member of the class-V pyridoxal-phosphate-dependent aminotransferase family. The encoded protein is a phosphoserine aminotransferase and decreased expression may be associated with schizophrenia. Mutations in this gene are also associated with phosphoserine aminotransferase deficiency. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene have been defined on chromosomes 1, 3, and 8. [provided by RefSeq, Jul 2013]
Orthologs
Proteins
| phosphoserine aminotransferase isoform 1 | |
|---|---|
| Refseq ID | NP_478059 |
| Protein GI | 17402893 |
| UniProt ID | Q9Y617 |
| mRNA ID | NM_058179 |
| Length | 370 |
| RefSeq Status | REVIEWED |
| MDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPDNYKVIFLQGGGCGQFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALRECPSVLEYKVQAGNSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSKMNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVTIEDVQKLAAFMKKFLEMHQL | |
| phosphoserine aminotransferase isoform 2 | |
|---|---|
| Refseq ID | NP_066977 |
| Protein GI | 10863955 |
| UniProt ID | Q9Y617 |
| mRNA ID | NM_021154 |
| Length | 324 |
| RefSeq Status | REVIEWED |
| MDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPDNYKVIFLQGGGCGQFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALRECPSVLEYKVQAGNSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVSVGGIRASLYNAVTIEDVQKLAAFMKKFLEMHQL | |
Gene Information
Entrez Gene ID
Gene Name
phosphoserine aminotransferase 1
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005829 | TAS:Reactome | C | cytosol |
| GO:0070062 | IDA:UniProt | C | extracellular vesicular exosome |
| GO:0004648 | NAS:UniProtKB | F | O-phospho-L-serine:2-oxoglutarate aminotransferase activity |
| GO:0030170 | IEA:InterPro | F | pyridoxal phosphate binding |
| GO:0006564 | NAS:UniProtKB | P | L-serine biosynthetic process |
| GO:0008652 | TAS:Reactome | P | cellular amino acid biosynthetic process |
| GO:0034641 | TAS:Reactome | P | cellular nitrogen compound metabolic process |
| GO:0008615 | NAS:UniProtKB | P | pyridoxine biosynthetic process |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| hsa01230 | Biosynthesis of amino acids |
| hsa01200 | Carbon metabolism |
| hsa00260 | Glycine, serine and threonine metabolism |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_115789 | Serine biosynthesis |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR000192 | Aminotransferase class V domain |
| IPR020578 | Aminotransferase class-V, pyridoxal-phosphate binding site |
| IPR022278 | Phosphoserine aminotransferase |
| IPR003248 | Phosphoserine aminotransferase, subgroup |
| IPR015424 | Pyridoxal phosphate-dependent transferase |
| IPR015421 | Pyridoxal phosphate-dependent transferase, major region, subdomain 1 |
| IPR015422 | Pyridoxal phosphate-dependent transferase, major region, subdomain 2 |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; Synonyms=Alpha; IsoId=Q9Y617-1; Sequence=Displayed; Name=2; Synonyms=Beta; IsoId=Q9Y617-2; Sequence=VSP_000237; |
| Catalytic Activity | 4-phosphonooxy-L-threonine + 2-oxoglutarate = (3R)-3-hydroxy-2-oxo-4-phosphonooxybutanoate + L-glutamate. |
| Catalytic Activity | O-phospho-L-serine + 2-oxoglutarate = 3- phosphonooxypyruvate + L-glutamate. |
| Cofactor | Name=pyridoxal 5'-phosphate; Xref=ChEBI |
| Disease | Phosphoserine aminotransferase deficiency (PSATD) [MIM |
| Function | Catalyzes the reversible conversion of 3- phosphohydroxypyruvate to phosphoserine and of 3-hydroxy-2-oxo-4- phosphonooxybutanoate to phosphohydroxythreonine. |
| Pathway | Amino-acid biosynthesis; L-serine biosynthesis; L-serine from 3-phospho-D-glycerate: step 2/3. |
| Pathway | Cofactor biosynthesis; pyridoxine 5'-phosphate biosynthesis; pyridoxine 5'-phosphate from D-erythrose 4- phosphate: step 3/5. |
| Similarity | Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. SerC subfamily. |
| Subunit | Homodimer. |
| Tissue Specificity | Expressed at high levels in the brain, liver, kidney and pancreas, and very weakly expressed in the thymus, prostate, testis and colon. |
Identical and Related Proteins
Unique RefSeq proteins for LMP005134 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 17402893 | RefSeq | NP_478059 | 370 | phosphoserine aminotransferase isoform 1 |
| 10863955 | RefSeq | NP_066977 | 324 | phosphoserine aminotransferase isoform 2 |
Identical Sequences to LMP005134 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:10863955 | GenBank | ADT47567.1 | 324 | Sequence 1228 from patent US 7842466 |
| GI:10863955 | GenBank | ADT47568.1 | 324 | Sequence 1229 from patent US 7842466 |
| GI:10863955 | GenBank | ADT47570.1 | 324 | Sequence 1231 from patent US 7842466 |
| GI:10863955 | GenBank | ADT50212.1 | 324 | Sequence 2229 from patent US 7842467 |
| GI:10863955 | GenBank | ADT50213.1 | 324 | Sequence 2230 from patent US 7842467 |
| GI:17402893 | GenBank | ADT50214.1 | 370 | Sequence 2231 from patent US 7842467 |
| GI:10863955 | GenBank | ADT50215.1 | 324 | Sequence 2232 from patent US 7842467 |
| GI:17402893 | GenBank | ADT50217.1 | 370 | Sequence 2234 from patent US 7842467 |
| GI:17402893 | GenBank | JAA04682.1 | 370 | phosphoserine aminotransferase 1 [Pan troglodytes] |
| GI:17402893 | GenBank | JAA12556.1 | 370 | phosphoserine aminotransferase 1 [Pan troglodytes] |
| GI:17402893 | GenBank | JAA42671.1 | 370 | phosphoserine aminotransferase 1 [Pan troglodytes] |
| GI:17402893 | GenBank | AIC56315.1 | 370 | PSAT1, partial [synthetic construct] |
Related Sequences to LMP005134 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:17402893 | DBBJ | BAG58215.1 | 415 | unnamed protein product [Homo sapiens] |
| GI:10863955 | GenBank | AAH04863.1 | 370 | Phosphoserine aminotransferase 1 [Homo sapiens] |
| GI:17402893 | GenBank | AAH16645.1 | 370 | Phosphoserine aminotransferase 1 [Homo sapiens] |
| GI:17402893 | GenBank | AAP36220.1 | 371 | Homo sapiens phosphoserine aminotransferase, partial [synthetic construct] |
| GI:17402893 | GenBank | AAX29106.1 | 371 | phosphoserine aminotransferase 1, partial [synthetic construct] |
| GI:10863955 | GenBank | ACM84193.1 | 335 | Sequence 9691 from patent US 6812339 |
| GI:10863955 | GenBank | JAA04682.1 | 370 | phosphoserine aminotransferase 1 [Pan troglodytes] |
| GI:10863955 | GenBank | JAA12556.1 | 370 | phosphoserine aminotransferase 1 [Pan troglodytes] |
| GI:17402893 | GenBank | AIC56316.1 | 370 | PSAT1, partial [synthetic construct] |
| GI:10863955 | RefSeq | XP_003267494.1 | 411 | PREDICTED: phosphoserine aminotransferase isoform 2 [Nomascus leucogenys] |
| GI:17402893 | RefSeq | XP_003811498.1 | 457 | PREDICTED: phosphoserine aminotransferase isoform X1 [Pan paniscus] |
| GI:10863955 | RefSeq | XP_003811499.1 | 411 | PREDICTED: phosphoserine aminotransferase isoform X2 [Pan paniscus] |