Gene/Proteome Database (LMPD)
Proteins
| nuclear receptor subfamily 2 group C member 1 | |
|---|---|
| Refseq ID | NP_035759 |
| Protein GI | 171846245 |
| UniProt ID | Q505F1 |
| mRNA ID | NM_011629 |
| Length | 590 |
| RefSeq Status | VALIDATED |
| MATIEEIAHQIIDQQMGEIVTEQQTGQKIQIVTALDHSTQGKQFILANHEGSTPGKVFLTTPDAAGVNQLFFTSPDLSAPHLQLLTEKSPDQGPNKVFDLCVVCGDKASGRHYGAITCEGCKGFFKRSIRKNLVYSCRGSKDCVINKHHRNRCQYCRLQRCIAFGMKQDSVQCERKPIEVSREKSSNCAASTEKIYIRKDLRSPLAATPTFVTDSETARSAGLLDSGMFVNIHPSGIKTEPAMLMAPDKAESCQGDLSTLASVVTSLANLGKAKDLSHCGGDMPVVQSLRNGDTSFGAFHHDIQTNGDVSRAFDTLAKALTPGESSACQSPEEGMEGSPHLIAGEPSFVEKEGPLLSESHVAFRLTMPSPMPEYLNVHYIGESASRLLFLSMHWALSIPSFQALGQENSISLVKAYWNELFTLGLAQCWQVMNVATILATFVNCLHSSLQQDKMSPERRKSLMEHIFKLQEFCNSMVKLCIDGHEYAYLKAIVLFSPDHPGLENMELIERFQEKAYVEFQDYITRTYPDDTYRLSRLLLRLPALRLMNATITEELFFKGLIGNVRIDSVIPHILKMEPADYNSQIIGHSL | |
Gene Information
Entrez Gene ID
Gene Name
nuclear receptor subfamily 2, group C, member 1
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016605 | IDA:UniProtKB | C | PML body |
| GO:0005634 | IDA:UniProtKB | C | nucleus |
| GO:0003677 | IDA:UniProtKB | F | DNA binding |
| GO:0042826 | IPI:UniProtKB | F | histone deacetylase binding |
| GO:0042803 | IPI:UniProtKB | F | protein homodimerization activity |
| GO:0043565 | IEA:InterPro | F | sequence-specific DNA binding |
| GO:0003700 | IEA:InterPro | F | sequence-specific DNA binding transcription factor activity |
| GO:0003707 | IEA:InterPro | F | steroid hormone receptor activity |
| GO:0008270 | IEA:InterPro | F | zinc ion binding |
| GO:0000122 | IDA:UniProtKB | P | negative regulation of transcription from RNA polymerase II promoter |
| GO:0045892 | IDA:UniProtKB | P | negative regulation of transcription, DNA-templated |
| GO:0048386 | IDA:UniProtKB | P | positive regulation of retinoic acid receptor signaling pathway |
| GO:0006351 | IEA:UniProtKB-KW | P | transcription, DNA-templated |
Domain Information
UniProt Annotations
Entry Information
Gene Name
nuclear receptor subfamily 2, group C, member 1
Protein Entry
Q505F1_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1 {ECO:0000269|PubMed:8858600, ECO:0000269|PubMed:9504722, ECO:0000269|PubMed:9694834}; IsoId=Q505F1-1; Sequence=Displayed; Name=2 ; Synonyms=TR2-11-t , TR2-11-truncated ; IsoId=Q505F1-2; Sequence=VSP_051921, VSP_051922; Note=Due to intron retention. ; |
| Developmental Stage | Isoform 1 is highly expressed in early to midgestation embryos, with expression leveling off at 15 dpc. Expressed in yolk sac erythrocytes at 9.5 dpc. After birth, expression in the testes remains at a basal level until puberty, begins to increase at postnatal day 16 (P16) and peaks at P20 to P24. Expression is maintained at a high level throughout adulthood. Isoform 2 peaks transiently at P24. {ECO:0000269|PubMed:12093744, ECO:0000269|PubMed:8595902, ECO:0000269|PubMed:8858600, ECO:0000269|PubMed:9071982}. |
| Disruption Phenotype | No visible phenotype. Mice exhibit normal spermatogenesis and testis development, as well as normal central nervous system development. NR2C1 and NR2C2 double null mutants result in early embryonic lethality and increased apoptosis. Embryos die around 7.5 dpc. {ECO:0000269|PubMed:12052874, ECO:0000269|PubMed:19131575}. |
| Function | Orphan nuclear receptor. Binds the IR7 element in the promoter of its own gene in an autoregulatory negative feedback mechanism. Primarily repressor of a broad range of genes including ESR1 and RARB. Together with NR2C2, forms the core of the DRED (direct repeat erythroid-definitive) complex that represses embryonic and fetal globin transcription. Binds to hormone response elements (HREs) consisting of two 5'-AGGTCA-3' half site direct repeat consensus sequences (By similarity). Also activator of OCT4 gene expression. Plays a fundamental role in early embryogenesis and regulates embryonic stem cell proliferation and differentiation. Mediator of retinoic acid-regulated preadipocyte proliferation. {ECO:0000250, ECO:0000269|PubMed:11463856, ECO:0000269|PubMed:12093744, ECO:0000269|PubMed:16130175, ECO:0000269|PubMed:16317770, ECO:0000269|PubMed:17187077, ECO:0000269|PubMed:17389641, ECO:0000269|PubMed:17431400, ECO:0000269|PubMed:17974920, ECO:0000269|PubMed:19131575, ECO:0000269|PubMed:8530418, ECO:0000269|PubMed:8858600, ECO:0000269|PubMed:9071982, ECO:0000269|PubMed:9774688}. |
| Induction | By ciliary neurotrophic factor (CNTF). Repressed by vitamin A. Induced by retinoic acid. {ECO:0000269|PubMed:19131575, ECO:0000269|PubMed:9694834}. |
| Ptm | Phosphorylated on several serine and threonine residues. Phosphorylation on Thr-210, stimulated by all-trans retinoic acid (atRA) mediates PML location and sumoylation in proliferating cells which then modulates its association with effector molecules, KAT2B and NRIP1. Phosphorylation on Ser-568 by PKC is important for protein stability and function as activator of RARB. |
| Ptm | Sumoylation requires both PIAS1 and UBE2I. Sumoylation appears to dissociate NR2C1 from the PML nuclear bodies. Enhances the interaction with NRIP1 but inhibits interaction with KAT2B. In proliferating cells, stimulation by all-trans retinoic acid, activation of MAPK1-mediated phosphorylation and recruitment to PML bodies with subsequent sumoylation, suppresses OCT4 expression. |
| Similarity | Belongs to the nuclear hormone receptor family. NR2 subfamily. |
| Similarity | Contains 1 nuclear receptor DNA-binding domain. |
| Subcellular Location | Nucleus. Nucleus, PML body. Note=Recruited by HDAC3, after all-trans retinoic acid stimulated MAPK1-mediated Thr-210 phosphorylation, to PML bodies for subsequent sumoylation. |
| Subunit | Homodimer. Heterodimer; with NR2C2 which is required for chromatin remodeling and for binding to promoter regions such as globin DR1 repeats. Interacts with ESR1; the interaction prevents homodimerization of ESR1 and suppresses its transcriptional activity and cell growth (By similarity). Interacts with NRIP1 (via its LXXLL motifs); the interaction provides corepressor activity. Interacts with HDAC3 (via the DNA-binding domain); the interaction recruits phosphorylated NR2C1 to PML bodies for sumoylation. Interacts with HDAC4 (via the DNA-binding domain). Interacts with PIAS1; the interaction is required for sumoylation of NR2C1. Interacts with UBE2I; the interaction is required for sumoylation of NR2C1. Interacts with KAT2B; the interaction acts as a corepressor of gene expression. {ECO:0000250, ECO:0000269|PubMed:11463856, ECO:0000269|PubMed:16317770, ECO:0000269|PubMed:17187077, ECO:0000269|PubMed:18682553, ECO:0000269|PubMed:19204783, ECO:0000269|PubMed:9774688}. |
| Tissue Specificity | Isoform 1 is highly expressed in the adlumenal compartment of the seminiferous tubule of adult testes (at protein level) and in the eyes of newborn animals. Weakly expressed in other adult organs including the seminal vesicle, prostate, ovary, adrenal gland, heart, thymus, placenta and brain. Expressed during embryonic stages in developing eyes, brain and cartilage primordia (at protein level). Also expressed in the developing spinal motor neurons and in the sympathetic-, parasympathetic- and sensory ganglia of the embryonic PNS. Expressed in the developing neural epithelia of the inner ear, nasal cavity, tongue and retina. At day 16.5, expressed in various tissues including kidney and intestine. In contrast, isoform 2 is widely expressed at a low level throughout the adult testis. {ECO:0000269|PubMed:12052874, ECO:0000269|PubMed:8530418, ECO:0000269|PubMed:8595902, ECO:0000269|PubMed:8858600, ECO:0000269|PubMed:9071982, ECO:0000269|PubMed:9504722, ECO:0000269|PubMed:9694834}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP005329 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 171846245 | RefSeq | NP_035759 | 590 | nuclear receptor subfamily 2 group C member 1 |
Identical Sequences to LMP005329 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:171846245 | DBBJ | BAE28842.1 | 590 | unnamed protein product [Mus musculus] |
| GI:171846245 | GenBank | AAH94580.1 | 590 | Nr2c1 protein [Mus musculus] |
| GI:171846245 | GenBank | AAH90662.1 | 590 | Nr2c1 protein [Mus musculus] |
| GI:171846245 | RefSeq | XP_006513655.1 | 590 | PREDICTED: nuclear receptor subfamily 2 group C member 1 isoform X2 [Mus musculus] |
| GI:171846245 | SwissProt | Q505F1.3 | 590 | RecName: Full=Nuclear receptor subfamily 2 group C member 1; AltName: Full=Orphan nuclear receptor TR2; AltName: Full=Testicular receptor 2; Short=mTR2 [Mus musculus] |
Related Sequences to LMP005329 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:171846245 | DBBJ | BAE27509.1 | 590 | unnamed protein product [Mus musculus] |
| GI:171846245 | EMBL | CAA72244.1 | 590 | orphan receptor [Mus musculus] |
| GI:171846245 | GenBank | AAC29502.1 | 590 | TR2 [Mus musculus] |
| GI:171846245 | GenBank | AAC52787.1 | 590 | orphan receptor [Mus musculus] |
| GI:171846245 | GenBank | AAL31315.1 | 590 | orphan receptor [Mus musculus] |
| GI:171846245 | RefSeq | XP_006513654.1 | 704 | PREDICTED: nuclear receptor subfamily 2 group C member 1 isoform X1 [Mus musculus] |