Gene/Proteome Database (LMPD)

LMPD ID
LMP005391
Gene ID
18823
Species
Mus musculus (Mouse)
Gene Name
proteolipid protein (myelin) 1
Gene Symbol
Plp1
Synonyms
DM20; Plp; jimpy; jp; msd; rsh
Alternate Names
myelin proteolipid protein; lipophilin; rump shaker; myelin synthesis deficiency
Chromosome
X
Map Location
X F1-F2|X 59.1 cM

Proteins

myelin proteolipid protein isoform 1
Refseq ID NP_035253
Protein GI 23956058
UniProt ID P60202
mRNA ID NM_011123
Length 277
RefSeq Status VALIDATED
MGLLECCARCLVGAPFASLVATGLCFFGVALFCGCGHEALTGTEKLIETYFSKNYQDYEYLINVIHAFQYVIYGTASFFFLYGALLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGGQKGRGSRGQHQAHSLERVCHCLGKWLGHPDKFVGITYALTVVWLLVFACSAVPVYIYFNTWTTCQSIAFPSKTSASIGSLCADARMYGVLPWNAFPGKVCGSNLLSICKTAEFQMTFHLFIAAFVGAAATLVSLLTFMIAATYNFAVLKLMGRGTKF
myelin proteolipid protein isoform 2
Refseq ID NP_001277490
Protein GI 594542470
UniProt ID P60202
mRNA ID NM_001290561
Length 242
RefSeq Status VALIDATED
MGLLECCARCLVGAPFASLVATGLCFFGVALFCGCGHEALTGTEKLIETYFSKNYQDYEYLINVIHAFQYVIYGTASFFFLYGALLLAEGFYTTGAVRQIFGDYKTTICGKGLSATFVGITYALTVVWLLVFACSAVPVYIYFNTWTTCQSIAFPSKTSASIGSLCADARMYGVLPWNAFPGKVCGSNLLSICKTAEFQMTFHLFIAAFVGAAATLVSLLTFMIAATYNFAVLKLMGRGTKF
myelin proteolipid protein isoform 3
Refseq ID NP_001277491
Protein GI 594542556
UniProt ID P60202
mRNA ID NM_001290562
Length 243
RefSeq Status VALIDATED
MGLLECCARCLVGAPFASLVATGLCFFGVALFCGCGHEALTGTEKLIETYFSKNYQDYEYLINVIHAFQYVIYGTASFFFLYGALLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGGQKGRGSRGQHQAHSLERVCHCLGKWLGHPDKFVGITYALTVVWLLVFACSAVPVYIYFNTWTTCQSIAFPSKTSASIGSLCADARMYVPNDLPPVYCCVCGCCGHTSFPAHLHDCCHLQLRRP

Gene Information

Entrez Gene ID
18823
Gene Name
proteolipid protein (myelin) 1
Gene Symbol
Plp1
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0043209 IDA:MGI C myelin sheath
GO:0005886 ISS:UniProtKB C plasma membrane
GO:0019911 IEA:Ensembl F structural constituent of myelin sheath
GO:0014002 IGI:MGI P astrocyte development
GO:0061564 IGI:MGI P axon development
GO:0008366 IMP:MGI P axon ensheathment
GO:0048469 IMP:MGI P cell maturation
GO:0022010 IMP:MGI P central nervous system myelination
GO:0006954 IGI:MGI P inflammatory response
GO:0007229 IEA:Ensembl P integrin-mediated signaling pathway
GO:0042759 IMP:MGI P long-chain fatty acid biosynthetic process
GO:0042552 IMP:MGI P myelination
GO:0010628 IMP:MGI P positive regulation of gene expression
GO:0021762 IEA:Ensembl P substantia nigra development

Domain Information

InterPro Annotations

Accession Description
IPR001614 Myelin proteolipid protein PLP
IPR018237 Myelin proteolipid protein PLP, conserved site

UniProt Annotations

Entry Information

Gene Name
proteolipid protein (myelin) 1
Protein Entry
MYPR_MOUSE
UniProt ID
P60202
Species
Mouse

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P60202-1; Sequence=Displayed; Name=DM-20; IsoId=P60202-2; Sequence=VSP_009194;
Disease Note=Defects in Plp1 are the cause of the dysmyelinating diseases Jimpy and Rumpshaker (rsh).
Function This is the major myelin protein from the central nervous system. It plays an important role in the formation or maintenance of the multilamellar structure of myelin.
Similarity Belongs to the myelin proteolipid protein family. {ECO:0000305}.
Subcellular Location Cell membrane {ECO:0000269|PubMed:17634366}; Multi-pass membrane protein {ECO:0000269|PubMed:17634366}. Myelin membrane {ECO:0000269|PubMed:17634366}. Note=Colocalizes with SIRT2 in internodal regions, at paranodal axoglial junction and Schmidt-Lanterman incisures of myelin sheat.

Identical and Related Proteins

Unique RefSeq proteins for LMP005391 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
23956058 RefSeq NP_035253 277 myelin proteolipid protein isoform 1
594542470 RefSeq NP_001277490 242 myelin proteolipid protein isoform 2
594542556 RefSeq NP_001277491 243 myelin proteolipid protein isoform 3

Identical Sequences to LMP005391 proteins

Reference Database Accession Length Protein Name
GI:594542556 GenBank AAA39952.1 243 jimpy mutant proteolipid protein, partial [Mus musculus]
GI:594542470 GenBank AIC54915.1 242 PLP1, partial [synthetic construct]
GI:594542470 GenBank AIS72845.1 242 proteolipid protein 1 transcript variant 2 [Rattus norvegicus]
GI:594542470 RefSeq XP_007086484.1 242 PREDICTED: myelin proteolipid protein isoform X2 [Panthera tigris altaica]
GI:594542470 RefSeq XP_008581877.1 242 PREDICTED: myelin proteolipid protein isoform X2 [Galeopterus variegatus]
GI:594542470 RefSeq XP_008702425.1 242 PREDICTED: myelin proteolipid protein [Ursus maritimus]
GI:23956058 RefSeq XP_008971306.1 277 PREDICTED: myelin proteolipid protein isoform X1 [Pan paniscus]
GI:23956058 RefSeq XP_008971307.1 277 PREDICTED: myelin proteolipid protein isoform X1 [Pan paniscus]
GI:23956058 RefSeq XP_008971308.1 277 PREDICTED: myelin proteolipid protein isoform X1 [Pan paniscus]
GI:23956058 RefSeq XP_008971309.1 277 PREDICTED: myelin proteolipid protein isoform X1 [Pan paniscus]
GI:23956058 RefSeq XP_008971310.1 277 PREDICTED: myelin proteolipid protein isoform X1 [Pan paniscus]
GI:23956058 RefSeq XP_009233351.1 277 PREDICTED: myelin proteolipid protein isoform X1 [Pongo abelii]
GI:594542470 RefSeq XP_009233352.1 242 PREDICTED: myelin proteolipid protein isoform X2 [Pongo abelii]

Related Sequences to LMP005391 proteins

Reference Database Accession Length Protein Name
GI:594542556 DBBJ BAG10260.1 277 myelin proteolipid protein, partial [synthetic construct]
GI:23956058 EMBL CAA39025.1 277 proteolipid protein (PLP) [Canis lupus familiaris]
GI:594542556 GenBank AAA39956.1 243 myelin proteolipid [Mus musculus]
GI:594542470 GenBank AAV38409.1 242 proteolipid protein 1 (Pelizaeus-Merzbacher disease, spastic paraplegia 2, uncomplicated) [Homo sapiens]
GI:594542556 GenBank ABJ47074.1 277 Sequence 7813 from patent US 7115416
GI:594542556 GenBank EAW54693.1 243 proteolipid protein 1 (Pelizaeus-Merzbacher disease, spastic paraplegia 2, uncomplicated), isoform CRA_c [Homo sapiens]
GI:594542556 GenBank ADS59502.1 243 Sequence 653 from patent US 7807392
GI:23956058 RefSeq NP_001013856.1 277 myelin proteolipid protein [Canis lupus familiaris]
GI:594542470 RefSeq XP_001493073.1 242 PREDICTED: myelin proteolipid protein isoform 1 [Equus caballus]
GI:594542470 RefSeq XP_002925967.1 242 PREDICTED: myelin proteolipid protein-like [Ailuropoda melanoleuca]
GI:594542470 RefSeq XP_004443783.1 242 PREDICTED: myelin proteolipid protein isoform 2 [Ceratotherium simum simum]
GI:23956058 RefSeq XP_005412054.1 277 PREDICTED: myelin proteolipid protein isoform X1 [Chinchilla lanigera]
GI:23956058 RefSeq XP_005868184.1 277 PREDICTED: myelin proteolipid protein isoform X1 [Myotis brandtii]
GI:23956058 RefSeq XP_006759124.1 277 PREDICTED: myelin proteolipid protein-like isoform X1 [Myotis davidii]
GI:594542556 RefSeq XP_007650690.1 243 PREDICTED: myelin proteolipid protein isoform X1 [Cricetulus griseus]
GI:594542470 RefSeq XP_008157408.1 242 PREDICTED: myelin proteolipid protein isoform X2 [Eptesicus fuscus]
GI:594542470 RefSeq XP_010608896.1 242 PREDICTED: myelin proteolipid protein isoform X2 [Fukomys damarensis]
GI:23956058 SwissProt P23294.2 277 RecName: Full=Myelin proteolipid protein; Short=PLP; AltName: Full=Lipophilin [Canis lupus familiaris]