Gene/Proteome Database (LMPD)
LMPD ID
LMP005420
Gene ID
Species
Homo sapiens (Human)
Gene Name
phosphoserine phosphatase
Gene Symbol
Synonyms
PSP; PSPHD
Alternate Names
phosphoserine phosphatase; PSPase; L-3-phosphoserine phosphatase; O-phosphoserine phosphohydrolase
Chromosome
7
Map Location
7p11.2
EC Number
3.1.3.3
Summary
The protein encoded by this gene belongs to a subfamily of the phosphotransferases. This encoded enzyme is responsible for the third and last step in L-serine formation. It catalyzes magnesium-dependent hydrolysis of L-phosphoserine and is also involved in an exchange reaction between L-serine and L-phosphoserine. Deficiency of this protein is thought to be linked to Williams syndrome. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
phosphoserine phosphatase | |
---|---|
Refseq ID | NP_004568 |
Protein GI | 46249388 |
UniProt ID | P78330 |
mRNA ID | NM_004577 |
Length | 225 |
RefSeq Status | REVIEWED |
MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005737 | IBA:RefGenome | C | cytoplasm |
GO:0005829 | TAS:Reactome | C | cytosol |
GO:0043005 | IEA:Ensembl | C | neuron projection |
GO:0005509 | IDA:UniProtKB | F | calcium ion binding |
GO:0000287 | IDA:UniProtKB | F | magnesium ion binding |
GO:0004647 | IDA:UniProtKB | F | phosphoserine phosphatase activity |
GO:0042803 | IPI:UniProtKB | F | protein homodimerization activity |
GO:0008652 | TAS:Reactome | P | cellular amino acid biosynthetic process |
GO:0034641 | TAS:Reactome | P | cellular nitrogen compound metabolic process |
GO:0016311 | IDA:GOC | P | dephosphorylation |
GO:0006564 | IBA:RefGenome | P | L-serine biosynthetic process |
GO:0006563 | IDA:UniProtKB | P | L-serine metabolic process |
GO:0009612 | IEA:Ensembl | P | response to mechanical stimulus |
GO:0031667 | IEA:Ensembl | P | response to nutrient levels |
GO:0033574 | IEA:Ensembl | P | response to testosterone |
GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
hsa01230 | Biosynthesis of amino acids |
hsa01200 | Carbon metabolism |
hsa00260 | Glycine, serine and threonine metabolism |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
REACT_115789 | Serine biosynthesis |
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Catalytic Activity | O-phospho-L(or D)-serine + H(2)O = L(or D)- serine + phosphate. {ECO |
Cofactor | Name=Mg(2+); Xref=ChEBI |
Disease | Phosphoserine phosphatase deficiency (PSPHD) [MIM |
Enzyme Regulation | Inhibited by calcium ions. |
Function | Catalyzes the last step in the biosynthesis of serine from carbohydrates. The reaction mechanism proceeds via the formation of a phosphoryl-enzyme intermediates. |
Interaction | Q9NVP2:ASF1B; NbExp=1; IntAct=EBI-1042956, EBI-1055650; Q14558:PRPSAP1; NbExp=1; IntAct=EBI-1042956, EBI-724449; Q9Y6J8:STYXL1; NbExp=1; IntAct=EBI-1042956, EBI-1044511; |
Pathway | Amino-acid biosynthesis; L-serine biosynthesis; L-serine from 3-phospho-D-glycerate: step 3/3. |
Similarity | Belongs to the SerB family. |
Subunit | Homodimer. {ECO |
Identical and Related Proteins
Unique RefSeq proteins for LMP005420 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
46249388 | RefSeq | NP_004568 | 225 | phosphoserine phosphatase |
Identical Sequences to LMP005420 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:46249388 | GenBank | AHD78619.1 | 225 | Sequence 26617 from patent US 8586006 |
GI:46249388 | GenBank | AIC49520.1 | 225 | PSPH, partial [synthetic construct] |
GI:46249388 | RefSeq | XP_005271832.1 | 225 | PREDICTED: phosphoserine phosphatase isoform X3 [Homo sapiens] |
GI:46249388 | RefSeq | XP_005271833.1 | 225 | PREDICTED: phosphoserine phosphatase isoform X4 [Homo sapiens] |
GI:46249388 | RefSeq | XP_005271834.1 | 225 | PREDICTED: phosphoserine phosphatase isoform X5 [Homo sapiens] |
GI:46249388 | RefSeq | XP_006715823.1 | 225 | PREDICTED: phosphoserine phosphatase isoform X6 [Homo sapiens] |
Related Sequences to LMP005420 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:46249388 | EMBL | CAA71318.1 | 225 | L-3-phosphoserine phosphatase [Homo sapiens] |
GI:46249388 | GenBank | EAX07970.1 | 252 | phosphoserine phosphatase, isoform CRA_b [Homo sapiens] |
GI:46249388 | GenBank | EAX07971.1 | 252 | phosphoserine phosphatase, isoform CRA_b [Homo sapiens] |
GI:46249388 | GenBank | ACM81024.1 | 225 | Sequence 6522 from patent US 6812339 |
GI:46249388 | PDB | 1NNL | 225 | Chain A, Crystal Structure Of Human Phosphoserine Phosphatase |
GI:46249388 | PDB | 1NNL | 225 | Chain B, Crystal Structure Of Human Phosphoserine Phosphatase |