Gene/Proteome Database (LMPD)
LMPD ID
LMP005421
Gene ID
Species
Mus musculus (Mouse)
Gene Name
myo-inositol oxygenase
Gene Symbol
Synonyms
0610009I10Rik; AI314022; Aldrl6; C85427; RSOR
Alternate Names
inositol oxygenase; MI oxygenase; aldehyde reductase-like 6; aldehyde reductase 6, renal; renal-specific oxidoreductase; renal-specific oxido-reducatse; aldehyde reductase (aldose reductase)-like 6
Chromosome
15
Map Location
15 E3|15
EC Number
1.13.99.1
Proteins
inositol oxygenase | |
---|---|
Refseq ID | NP_064361 |
Protein GI | 45504405 |
UniProt ID | Q9QXN5 |
mRNA ID | NM_019977 |
Length | 285 |
RefSeq Status | PROVISIONAL |
MKVDVGPDPSLVYRPDVDPEMAKSKDSFRNYTSGPLLDRVFTTYKLMHTHQTVDFVSRKRIQYGSFSYKKMTIMEAVGMLDDLVDESDPDVDFPNSFHAFQTAEGIRKAHPDKDWFHLVGLLHDLGKIMALWGEPQWAVVGDTFPVGCRPQASVVFCDSTFQDNPDLQDPRYSTELGMYQPHCGLENVLMSWGHDEYLYQMMKFNKFSLPSEAFYMIRFHSFYPWHTGGDYRQLCSQQDLDMLPWVQEFNKFDLYTKCPDLPDVESLRPYYQGLIDKYCPGTLSW |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005737 | IDA:UniProtKB | C | cytoplasm |
GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
GO:0016234 | ISS:UniProtKB | C | inclusion body |
GO:0050661 | IEA:Ensembl | F | NADP binding |
GO:0004033 | IDA:UniProtKB | F | aldo-keto reductase (NADP) activity |
GO:0008199 | ISS:UniProtKB | F | ferric iron binding |
GO:0050113 | ISS:UniProtKB | F | inositol oxygenase activity |
GO:0016491 | TAS:MGI | F | oxidoreductase activity |
GO:0016651 | IDA:UniProtKB | F | oxidoreductase activity, acting on NAD(P)H |
GO:0016701 | ISS:UniProtKB | F | oxidoreductase activity, acting on single donors with incorporation of molecular oxygen |
GO:0019310 | ISS:UniProtKB | P | inositol catabolic process |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Catalytic Activity | Myo-inositol + O(2) = D-glucuronate + H(2)O. |
Cofactor | Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence={ECO:0000269|PubMed:17012379, ECO:0000269|PubMed:18364358}; Note=Binds 2 iron ions per subunit. {ECO:0000269|PubMed:17012379, ECO:0000269|PubMed:18364358}; |
Pathway | Polyol metabolism; myo-inositol degradation into D- glucuronate; D-glucuronate from myo-inositol: step 1/1. |
Similarity | Belongs to the myo-inositol oxygenase family. {ECO:0000305}. |
Subcellular Location | Cytoplasm {ECO:0000250}. |
Tissue Specificity | Kidney specific. Renal proximal tubules. {ECO:0000269|PubMed:10944187}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP005421 (as displayed in Record Overview)
Identical Sequences to LMP005421 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:45504405 | GenBank | AAH13543.1 | 285 | Myo-inositol oxygenase [Mus musculus] |
GI:45504405 | GenBank | AAV65815.1 | 285 | myo-inositol oxygenase [Mus musculus] |
GI:45504405 | GenBank | EDL04356.1 | 285 | myo-inositol oxygenase [Mus musculus] |
GI:45504405 | SwissProt | Q9QXN5.2 | 285 | RecName: Full=Inositol oxygenase; AltName: Full=Aldehyde reductase-like 6; AltName: Full=Myo-inositol oxygenase; Short=MI oxygenase; AltName: Full=Renal-specific oxidoreductase [Mus musculus] |
Related Sequences to LMP005421 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:45504405 | GenBank | AAF25202.1 | 285 | unknown [Mus musculus] |
GI:45504405 | GenBank | ACH37018.1 | 285 | Sequence 12 from patent US 7411113 |
GI:45504405 | GenBank | ADS97249.1 | 285 | Sequence 12 from patent US 7829760 |
GI:45504405 | GenBank | ADS97250.1 | 285 | Sequence 13 from patent US 7829760 |
GI:45504405 | PDB | 2HUO | 289 | Chain A, Crystal Structure Of Mouse Myo-Inositol Oxygenase In Complex With Substrate |
GI:45504405 | PDB | 3BXD | 289 | Chain A, Crystal Structure Of Mouse Myo-Inositol Oxygenase (Re-Refined) |