Gene/Proteome Database (LMPD)

LMPD ID
LMP005421
Gene ID
Species
Mus musculus (Mouse)
Gene Name
myo-inositol oxygenase
Gene Symbol
Synonyms
0610009I10Rik; AI314022; Aldrl6; C85427; RSOR
Alternate Names
inositol oxygenase; MI oxygenase; aldehyde reductase-like 6; aldehyde reductase 6, renal; renal-specific oxidoreductase; renal-specific oxido-reducatse; aldehyde reductase (aldose reductase)-like 6
Chromosome
15
Map Location
15 E3|15
EC Number
1.13.99.1

Proteins

inositol oxygenase
Refseq ID NP_064361
Protein GI 45504405
UniProt ID Q9QXN5
mRNA ID NM_019977
Length 285
RefSeq Status PROVISIONAL
MKVDVGPDPSLVYRPDVDPEMAKSKDSFRNYTSGPLLDRVFTTYKLMHTHQTVDFVSRKRIQYGSFSYKKMTIMEAVGMLDDLVDESDPDVDFPNSFHAFQTAEGIRKAHPDKDWFHLVGLLHDLGKIMALWGEPQWAVVGDTFPVGCRPQASVVFCDSTFQDNPDLQDPRYSTELGMYQPHCGLENVLMSWGHDEYLYQMMKFNKFSLPSEAFYMIRFHSFYPWHTGGDYRQLCSQQDLDMLPWVQEFNKFDLYTKCPDLPDVESLRPYYQGLIDKYCPGTLSW

Gene Information

Entrez Gene ID
Gene Name
myo-inositol oxygenase
Gene Symbol
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IDA:UniProtKB C cytoplasm
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0016234 ISS:UniProtKB C inclusion body
GO:0050661 IEA:Ensembl F NADP binding
GO:0004033 IDA:UniProtKB F aldo-keto reductase (NADP) activity
GO:0008199 ISS:UniProtKB F ferric iron binding
GO:0050113 ISS:UniProtKB F inositol oxygenase activity
GO:0016491 TAS:MGI F oxidoreductase activity
GO:0016651 IDA:UniProtKB F oxidoreductase activity, acting on NAD(P)H
GO:0016701 ISS:UniProtKB F oxidoreductase activity, acting on single donors with incorporation of molecular oxygen
GO:0019310 ISS:UniProtKB P inositol catabolic process

KEGG Pathway Links

KEGG Pathway ID Description
ko00053 Ascorbate and aldarate metabolism
mmu00053 Ascorbate and aldarate metabolism
ko00562 Inositol phosphate metabolism
mmu00562 Inositol phosphate metabolism

Domain Information

InterPro Annotations

Accession Description
IPR018170 Aldo/keto reductase, conserved site
IPR007828 Inositol_oxygenase

UniProt Annotations

Entry Information

Gene Name
myo-inositol oxygenase
Protein Entry
MIOX_MOUSE
UniProt ID
Species
Mouse

Comments

Comment Type Description
Catalytic Activity Myo-inositol + O(2) = D-glucuronate + H(2)O.
Cofactor Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence={ECO:0000269|PubMed:17012379, ECO:0000269|PubMed:18364358}; Note=Binds 2 iron ions per subunit. {ECO:0000269|PubMed:17012379, ECO:0000269|PubMed:18364358};
Pathway Polyol metabolism; myo-inositol degradation into D- glucuronate; D-glucuronate from myo-inositol: step 1/1.
Similarity Belongs to the myo-inositol oxygenase family. {ECO:0000305}.
Subcellular Location Cytoplasm {ECO:0000250}.
Tissue Specificity Kidney specific. Renal proximal tubules. {ECO:0000269|PubMed:10944187}.

Identical and Related Proteins

Unique RefSeq proteins for LMP005421 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
45504405 RefSeq NP_064361 285 inositol oxygenase

Identical Sequences to LMP005421 proteins

Reference Database Accession Length Protein Name
GI:45504405 GenBank AAH13543.1 285 Myo-inositol oxygenase [Mus musculus]
GI:45504405 GenBank AAV65815.1 285 myo-inositol oxygenase [Mus musculus]
GI:45504405 GenBank EDL04356.1 285 myo-inositol oxygenase [Mus musculus]
GI:45504405 SwissProt Q9QXN5.2 285 RecName: Full=Inositol oxygenase; AltName: Full=Aldehyde reductase-like 6; AltName: Full=Myo-inositol oxygenase; Short=MI oxygenase; AltName: Full=Renal-specific oxidoreductase [Mus musculus]

Related Sequences to LMP005421 proteins

Reference Database Accession Length Protein Name
GI:45504405 GenBank AAF25202.1 285 unknown [Mus musculus]
GI:45504405 GenBank ACH37018.1 285 Sequence 12 from patent US 7411113
GI:45504405 GenBank ADS97249.1 285 Sequence 12 from patent US 7829760
GI:45504405 GenBank ADS97250.1 285 Sequence 13 from patent US 7829760
GI:45504405 PDB 2HUO 289 Chain A, Crystal Structure Of Mouse Myo-Inositol Oxygenase In Complex With Substrate
GI:45504405 PDB 3BXD 289 Chain A, Crystal Structure Of Mouse Myo-Inositol Oxygenase (Re-Refined)