Gene/Proteome Database (LMPD)
Proteins
lysocardiolipin acyltransferase 1 | |
---|---|
Refseq ID | NP_001074540 |
Protein GI | 124486722 |
UniProt ID | Q3UN02 |
mRNA ID | NM_001081071 |
Length | 376 |
RefSeq Status | VALIDATED |
MVSWKGIYFILFLFAGSFFGSIFMLGPILPLMFINLSWYRWISSRLVATWLTLPVALLETMFGVRVVITGDAFVPGERSVIIMNHRTRVDWMFLWNCLMRYSYLRVEKICLKSSLKSVPGFGWAMQVAAFIFIHRKWKDDKSHFEDMIDYFCAIHEPLQLLIFPEGTDLTENNKARSNDFAEKNGLQKYEYVLHPRTTGFTFVVDRLREGKNLDAVHDITVAYPYNIPQTEKHLLLGDFPKEIHFHVQRYPADSLPTSKEDLQLWCHRRWEEKEERLRSFYQGEKNFHFTGQSTVPPCKSELRVLVVKLLSIVYWALFCSAMCLLIYLYSPVRWYFIISIVFFVLQERIFGGLEIIELACYRFLHKHPHLNSKKNE |
lysocardiolipin acyltransferase 1 | |
---|---|
Refseq ID | NP_001171438 |
Protein GI | 295789098 |
UniProt ID | Q3UN02 |
mRNA ID | NM_001177967 |
Length | 376 |
RefSeq Status | VALIDATED |
Protein sequence is identical to GI:124486722 (mRNA isoform) |
lysocardiolipin acyltransferase 1 | |
---|---|
Refseq ID | NP_001171439 |
Protein GI | 295789100 |
UniProt ID | Q3UN02 |
mRNA ID | NM_001177968 |
Length | 376 |
RefSeq Status | VALIDATED |
Protein sequence is identical to GI:124486722 (mRNA isoform) |
Gene Information
Entrez Gene ID
Gene Name
lysocardiolipin acyltransferase 1
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IDA:MGI | C | endoplasmic reticulum |
GO:0016020 | IEA:Ensembl | C | membrane |
GO:0016746 | IDA:MGI | F | transferase activity, transferring acyl groups |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR002123 | Phospholipid/glycerol acyltransferase |
UniProt Annotations
Entry Information
Gene Name
lysocardiolipin acyltransferase 1
Protein Entry
LCLT1_MOUSE
UniProt ID
Species
Mouse
Identical and Related Proteins
Unique RefSeq proteins for LMP005442 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
124486722 | RefSeq | NP_001074540 | 376 | lysocardiolipin acyltransferase 1 |
Identical Sequences to LMP005442 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:124486722 | GenBank | AAI47500.1 | 376 | Lclat1 protein [Mus musculus] |
GI:124486722 | GenBank | AAI58077.1 | 376 | Lysocardiolipin acyltransferase 1 [Mus musculus] |
GI:124486722 | GenBank | AAI58080.1 | 376 | Lysocardiolipin acyltransferase 1 [Mus musculus] |
GI:124486722 | GenBank | AAI50885.1 | 376 | Lclat1 protein [Mus musculus] |
GI:124486722 | RefSeq | NP_001171438.1 | 376 | lysocardiolipin acyltransferase 1 [Mus musculus] |
GI:124486722 | RefSeq | NP_001171439.1 | 376 | lysocardiolipin acyltransferase 1 [Mus musculus] |
Related Sequences to LMP005442 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:124486722 | GenBank | EDM02860.1 | 376 | similar to lysocardiolipin acyltransferase isoform 1 (predicted) [Rattus norvegicus] |
GI:124486722 | RefSeq | XP_006524251.1 | 492 | PREDICTED: lysocardiolipin acyltransferase 1 isoform X1 [Mus musculus] |
GI:124486722 | RefSeq | XP_008774410.1 | 376 | PREDICTED: lysocardiolipin acyltransferase 1 isoform X2 [Rattus norvegicus] |
GI:124486722 | RefSeq | XP_008774411.1 | 376 | PREDICTED: lysocardiolipin acyltransferase 1 isoform X2 [Rattus norvegicus] |
GI:124486722 | RefSeq | XP_008762759.1 | 376 | PREDICTED: lysocardiolipin acyltransferase 1 isoform X2 [Rattus norvegicus] |
GI:124486722 | RefSeq | XP_008762760.1 | 376 | PREDICTED: lysocardiolipin acyltransferase 1 isoform X2 [Rattus norvegicus] |