Gene/Proteome Database (LMPD)
LMPD ID
LMP005462
Gene ID
Species
Mus musculus (Mouse)
Gene Name
glutathione peroxidase 6
Gene Symbol
Synonyms
1700020G18Rik; Ry2d1; olfactory
Alternate Names
glutathione peroxidase 6; GPx-6; GSHPx-6; odorant-metabolizing protein RY2D1
Chromosome
13
Map Location
13 A3.1|13
EC Number
1.11.1.9
Summary
This gene encodes a member of the glutathione peroxidase family. Glutathione peroxidases catalyze the reduction of a variety of hydroperoxides, using glutathione as a specific electron donor substrate. The mouse and the rat orthologs contain Cys, unlike their human counterpart, which is a selenoprotein containing Sec (selenocysteine) at its active site. Expression of this gene is restricted to embryos and adult olfactory epithelium. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
glutathione peroxidase 6 precursor | |
---|---|
Refseq ID | NP_663426 |
Protein GI | 146260278 |
UniProt ID | Q91WR8 |
mRNA ID | NM_145451 |
Length | 221 |
RefSeq Status | REVIEWED |
MAQKLWGSCLFSLFMAALAQETLNPQKSKVDCNKGVTGTVYEYGANTIDGGEFVNFQQYAGKHILFVNVASFCGLTATYPELNTLQEELKPFNVTVLGFPCNQFGKQEPGKNSEILLGLKYVRPGGGYVPNFQLFEKGDVNGDNEQKVFSFLKNSCPPTSELFGSPEHLFWDPMKVHDIRWNFEKFLVGPDGVPVMRWFHHTPVRIVQSDIMEYLNQTSTQ | |
sig_peptide: 1..19 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2089 peptide sequence: MAQKLWGSCLFSLFMAALA |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005576 | IEA:UniProtKB-KW | C | extracellular region |
GO:0004602 | IEA:UniProtKB-EC | F | glutathione peroxidase activity |
GO:0006979 | IEA:InterPro | P | response to oxidative stress |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
mmu04918 | Thyroid hormone synthesis |
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Catalytic Activity | 2 glutathione + H(2)O(2) = glutathione disulfide + 2 H(2)O. |
Similarity | Belongs to the glutathione peroxidase family. {ECO:0000305}. |
Subcellular Location | Secreted {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP005462 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
146260278 | RefSeq | NP_663426 | 221 | glutathione peroxidase 6 precursor |
Identical Sequences to LMP005462 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:146260278 | SwissProt | Q91WR8.2 | 221 | RecName: Full=Glutathione peroxidase 6; Short=GPx-6; Short=GSHPx-6; Flags: Precursor [Mus musculus] |
Related Sequences to LMP005462 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:146260278 | GenBank | ERE79967.1 | 221 | glutathione peroxidase 6-like protein [Cricetulus griseus] |
GI:146260278 | RefSeq | XP_003505660.1 | 221 | PREDICTED: glutathione peroxidase 6 [Cricetulus griseus] |
GI:146260278 | RefSeq | XP_005086722.1 | 221 | PREDICTED: glutathione peroxidase 6 [Mesocricetus auratus] |
GI:146260278 | RefSeq | XP_005369956.1 | 221 | PREDICTED: glutathione peroxidase 6 [Microtus ochrogaster] |
GI:146260278 | RefSeq | XP_006516860.1 | 233 | PREDICTED: glutathione peroxidase 6 isoform X1 [Mus musculus] |
GI:146260278 | RefSeq | XP_006988952.1 | 221 | PREDICTED: glutathione peroxidase 6 [Peromyscus maniculatus bairdii] |