Gene/Proteome Database (LMPD)

LMPD ID
LMP005462
Gene ID
Species
Mus musculus (Mouse)
Gene Name
glutathione peroxidase 6
Gene Symbol
Synonyms
1700020G18Rik; Ry2d1; olfactory
Alternate Names
glutathione peroxidase 6; GPx-6; GSHPx-6; odorant-metabolizing protein RY2D1
Chromosome
13
Map Location
13 A3.1|13
EC Number
1.11.1.9
Summary
This gene encodes a member of the glutathione peroxidase family. Glutathione peroxidases catalyze the reduction of a variety of hydroperoxides, using glutathione as a specific electron donor substrate. The mouse and the rat orthologs contain Cys, unlike their human counterpart, which is a selenoprotein containing Sec (selenocysteine) at its active site. Expression of this gene is restricted to embryos and adult olfactory epithelium. [provided by RefSeq, Jul 2008]
Orthologs

Proteins

glutathione peroxidase 6 precursor
Refseq ID NP_663426
Protein GI 146260278
UniProt ID Q91WR8
mRNA ID NM_145451
Length 221
RefSeq Status REVIEWED
MAQKLWGSCLFSLFMAALAQETLNPQKSKVDCNKGVTGTVYEYGANTIDGGEFVNFQQYAGKHILFVNVASFCGLTATYPELNTLQEELKPFNVTVLGFPCNQFGKQEPGKNSEILLGLKYVRPGGGYVPNFQLFEKGDVNGDNEQKVFSFLKNSCPPTSELFGSPEHLFWDPMKVHDIRWNFEKFLVGPDGVPVMRWFHHTPVRIVQSDIMEYLNQTSTQ
sig_peptide: 1..19 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2089 peptide sequence: MAQKLWGSCLFSLFMAALA

Gene Information

Entrez Gene ID
Gene Name
glutathione peroxidase 6
Gene Symbol
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005576 IEA:UniProtKB-KW C extracellular region
GO:0004602 IEA:UniProtKB-EC F glutathione peroxidase activity
GO:0006979 IEA:InterPro P response to oxidative stress

KEGG Pathway Links

KEGG Pathway ID Description
mmu04918 Thyroid hormone synthesis

Domain Information

InterPro Annotations

Accession Description
IPR000889 Glutathione peroxidase
IPR029759 Glutathione peroxidase active site
IPR029760 Glutathione peroxidase conserved site
IPR012336 Thioredoxin-like fold

UniProt Annotations

Entry Information

Gene Name
glutathione peroxidase 6
Protein Entry
GPX6_MOUSE
UniProt ID
Species
Mouse

Comments

Comment Type Description
Catalytic Activity 2 glutathione + H(2)O(2) = glutathione disulfide + 2 H(2)O.
Similarity Belongs to the glutathione peroxidase family. {ECO:0000305}.
Subcellular Location Secreted {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP005462 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
146260278 RefSeq NP_663426 221 glutathione peroxidase 6 precursor

Identical Sequences to LMP005462 proteins

Reference Database Accession Length Protein Name
GI:146260278 SwissProt Q91WR8.2 221 RecName: Full=Glutathione peroxidase 6; Short=GPx-6; Short=GSHPx-6; Flags: Precursor [Mus musculus]

Related Sequences to LMP005462 proteins

Reference Database Accession Length Protein Name
GI:146260278 GenBank ERE79967.1 221 glutathione peroxidase 6-like protein [Cricetulus griseus]
GI:146260278 RefSeq XP_003505660.1 221 PREDICTED: glutathione peroxidase 6 [Cricetulus griseus]
GI:146260278 RefSeq XP_005086722.1 221 PREDICTED: glutathione peroxidase 6 [Mesocricetus auratus]
GI:146260278 RefSeq XP_005369956.1 221 PREDICTED: glutathione peroxidase 6 [Microtus ochrogaster]
GI:146260278 RefSeq XP_006516860.1 233 PREDICTED: glutathione peroxidase 6 isoform X1 [Mus musculus]
GI:146260278 RefSeq XP_006988952.1 221 PREDICTED: glutathione peroxidase 6 [Peromyscus maniculatus bairdii]