Gene/Proteome Database (LMPD)

LMPD ID
LMP005547
Gene ID
4973
Species
Homo sapiens (Human)
Gene Name
oxidized low density lipoprotein (lectin-like) receptor 1
Gene Symbol
OLR1
Synonyms
CLEC8A; LOX1; LOXIN; SCARE1; SLOX1
Alternate Names
oxidized low-density lipoprotein receptor 1; hLOX-1; ox LDL receptor 1; lectin-type oxidized LDL receptor 1; scavenger receptor class E, member 1; C-type lectin domain family 8 member A; oxidized low-density lipoprotein receptor 1, soluble form
Chromosome
12
Map Location
12p13.2-p12.3
Summary
This gene encodes a low density lipoprotein receptor that belongs to the C-type lectin superfamily. This gene is regulated through the cyclic AMP signaling pathway. The encoded protein binds, internalizes and degrades oxidized low-density lipoprotein. This protein may be involved in the regulation of Fas-induced apoptosis. This protein may play a role as a scavenger receptor. Mutations of this gene have been associated with atherosclerosis, risk of myocardial infarction, and may modify the risk of Alzheimer's disease. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Feb 2010]
Orthologs
View orthologs and multiple alignments for OLR1

Proteins

oxidized low-density lipoprotein receptor 1 isoform 1
Refseq ID NP_002534
Protein GI 4505501
UniProt ID P78380
mRNA ID NM_002543
Length 273
RefSeq Status REVIEWED
MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQLSQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ
oxidized low-density lipoprotein receptor 1 isoform 2
Refseq ID NP_001166103
Protein GI 290654342
UniProt ID P78380
mRNA ID NM_001172632
Length 181
RefSeq Status REVIEWED
MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQLSQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSGLHPASNFLFQFSILDGAVSEEPQLPMALGGRFSFDAPLI
oxidized low-density lipoprotein receptor 1 isoform 3
Refseq ID NP_001166104
Protein GI 290654344
UniProt ID P78380
mRNA ID NM_001172633
Length 189
RefSeq Status REVIEWED
MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQLSQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLI

Gene Information

Entrez Gene ID
4973
Gene Name
oxidized low density lipoprotein (lectin-like) receptor 1
Gene Symbol
OLR1
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0070062 IDA:UniProt C extracellular vesicular exosome
GO:0005887 TAS:ProtInc C integral component of plasma membrane
GO:0043231 IDA:HPA C intracellular membrane-bounded organelle
GO:0016020 TAS:ProtInc C membrane
GO:0005634 IDA:HPA C nucleus
GO:0005886 IDA:HPA C plasma membrane
GO:0043235 IDA:MGI C receptor complex
GO:0030246 IEA:UniProtKB-KW F carbohydrate binding
GO:0005041 IEA:Ensembl F low-density lipoprotein receptor activity
GO:0008015 TAS:ProtInc P blood circulation
GO:0007596 TAS:Reactome P blood coagulation
GO:0008219 IEA:Ensembl P cell death
GO:0006954 IEA:UniProtKB-KW P inflammatory response
GO:0007159 IEA:Ensembl P leukocyte cell-cell adhesion
GO:0050900 TAS:Reactome P leukocyte migration
GO:0042157 IEA:Ensembl P lipoprotein metabolic process
GO:0006508 TAS:ProtInc P proteolysis
GO:0042542 IEA:Ensembl P response to hydrogen peroxide

KEGG Pathway Links

KEGG Pathway ID Description
hsa03320 PPAR signaling pathway
hsa04145 Phagosome
ko04145 Phagosome

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_12051 Cell surface interactions at the vascular wall

Domain Information

InterPro Annotations

Accession Description
IPR001304 C-type_lectin
IPR016186 C-type_lectin-like
IPR016187 C-type_lectin_fold

UniProt Annotations

Entry Information

Gene Name
oxidized low density lipoprotein (lectin-like) receptor 1
Protein Entry
OLR1_HUMAN
UniProt ID
P78380
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=P78380-1; Sequence=Displayed; Name=2; IsoId=P78380-2; Sequence=VSP_042555; Note=No experimental confirmation available.; Name=3; IsoId=P78380-3; Sequence=VSP_045277; Note=No experimental confirmation available.;
Disease Note=Independent association genetic studies have implicated OLR1 gene variants in myocardial infarction susceptibility.
Disease Note=OLR1 may be involved in Alzheimer disease (AD). Involvement in AD is however unclear: according to some authors (PubMed:12354387, PubMed:12810610 and PubMed:15976314), variations in OLR1 modify the risk of AD, while according to other (PubMed:15000751 and PubMed:15060104) they do not. {ECO
Domain The C-type lectin domain mediates the recognition and binding of oxLDL.
Domain The cytoplasmic region is required for subcellular sorting on the cell surface.
Function Receptor that mediates the recognition, internalization and degradation of oxidatively modified low density lipoprotein (oxLDL) by vascular endothelial cells. OxLDL is a marker of atherosclerosis that induces vascular endothelial cell activation and dysfunction, resulting in pro-inflammatory responses, pro- oxidative conditions and apoptosis. Its association with oxLDL induces the activation of NF-kappa-B through an increased production of intracellular reactive oxygen and a variety of pro- atherogenic cellular responses including a reduction of nitric oxide (NO) release, monocyte adhesion and apoptosis. In addition to binding oxLDL, it acts as a receptor for the HSP70 protein involved in antigen cross-presentation to naive T-cells in dendritic cells, thereby participating in cell-mediated antigen cross-presentation. Also involved in inflammatory process, by acting as a leukocyte-adhesion molecule at the vascular interface in endotoxin-induced inflammation. Also acts as a receptor for advanced glycation end (AGE) products, activated platelets, monocytes, apoptotic cells and both Gram-negative and Gram- positive bacteria. {ECO
Induction By inflammatory cytokines such as TNF, IFNG/IFN-gamma, IL6/interleukin-6 and by pathological conditions such as hyperlipidemia, hypertension and diabetes mellitus. Up-regulated in atherosclerotic lesions, by oxLDL, reactive oxygen species and fluid shear stress, suggesting that it may participate in amplification of oxLDL-induced vascular dysfunction.
Interaction P50991:CCT4; NbExp=3; IntAct=EBI-7151999, EBI-356876; P17987:TCP1; NbExp=5; IntAct=EBI-7151999, EBI-356553;
Ptm N-glycosylated.
Ptm The intrachain disulfide-bonds prevent N-glycosylation at some sites.
Similarity Contains 1 C-type lectin domain. {ECO
Subcellular Location Cell membrane; Lipid-anchor. Cell membrane; Single-pass type II membrane protein. Membrane raft. Secreted. Note=A secreted form also exists. Localization to membrane rafts requires palmitoylation.
Subunit Homodimer; disulfide-linked. May form a hexamer composed of 3 homodimers. Interacts with HSP70. {ECO
Tissue Specificity Expressed at high level in endothelial cells and vascular-rich organs such as placenta, lung, liver and brain, aortic intima, bone marrow, spinal cord and substantia nigra. Also expressed at the surface of dendritic cells. Widely expressed at intermediate and low level. {ECO
Web Resource Name=Functional Glycomics Gateway - Glycan Binding; Note=Oxidized LDL receptor; URL="http://www.functionalglycomics.org/glycomics/GBPServlet?&operationType=view&cbpId=cbp_hum_Ctlect_249";

Identical and Related Proteins

Unique RefSeq proteins for LMP005547 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
4505501 RefSeq NP_002534 273 oxidized low-density lipoprotein receptor 1 isoform 1
290654342 RefSeq NP_001166103 181 oxidized low-density lipoprotein receptor 1 isoform 2
290654344 RefSeq NP_001166104 189 oxidized low-density lipoprotein receptor 1 isoform 3

Identical Sequences to LMP005547 proteins

Reference Database Accession Length Protein Name
GI:290654342 DBBJ BAG58360.1 181 unnamed protein product [Homo sapiens]
GI:4505501 EMBL CCQ77677.1 273 unnamed protein product [Homo sapiens]
GI:290654342 GenBank EAW96157.1 181 oxidised low density lipoprotein (lectin-like) receptor 1, isoform CRA_b [Homo sapiens]
GI:290654344 GenBank EAW96158.1 189 oxidised low density lipoprotein (lectin-like) receptor 1, isoform CRA_c [Homo sapiens]
GI:4505501 GenBank AEN26391.1 273 Sequence 2 from patent US 7993643
GI:4505501 GenBank AFK99919.1 273 Sequence 47 from patent US 8163503
GI:4505501 GenBank AFL62697.1 273 Sequence 1 from patent US 8187873
GI:4505501 GenBank AHD73226.1 273 Sequence 10294 from patent US 8586006
GI:4505501 GenBank AIC49310.1 273 OLR1, partial [synthetic construct]

Related Sequences to LMP005547 proteins

Reference Database Accession Length Protein Name
GI:4505501 DBBJ BAC81565.1 273 oxidised low density lipoprotein (lectin-like) receptor 1 [Homo sapiens]
GI:4505501 DBBJ BAF84813.1 273 unnamed protein product [Homo sapiens]
GI:290654344 EMBL CAB38175.1 273 LOX1 [Homo sapiens]
GI:290654344 GenBank AAC82329.1 273 oxidized low-density lipoprotein receptor [Homo sapiens]
GI:290654344 GenBank AAC97927.1 273 lectin-type oxidized LDL receptor [Homo sapiens]
GI:290654344 GenBank AAE29518.1 273 Sequence 6 from patent US 5962260
GI:290654344 GenBank AAE62634.1 273 Sequence 6 from patent US 6197937
GI:290654342 GenBank AAE62634.1 273 Sequence 6 from patent US 6197937
GI:4505501 GenBank JAA02288.1 273 oxidized low density lipoprotein (lectin-like) receptor 1 [Pan troglodytes]
GI:290654344 RefSeq NP_002534.1 273 oxidized low-density lipoprotein receptor 1 isoform 1 [Homo sapiens]
GI:4505501 RefSeq XP_001145768.1 273 PREDICTED: oxidized low-density lipoprotein receptor 1 [Pan troglodytes]
GI:4505501 RefSeq XP_002822951.1 273 PREDICTED: oxidized low-density lipoprotein receptor 1 isoform X1 [Pongo abelii]
GI:290654342 RefSeq XP_003265529.1 181 PREDICTED: oxidized low-density lipoprotein receptor 1 isoform 3 [Nomascus leucogenys]
GI:4505501 RefSeq XP_003829682.1 273 PREDICTED: oxidized low-density lipoprotein receptor 1 [Pan paniscus]
GI:290654342 RefSeq XP_006719144.1 217 PREDICTED: oxidized low-density lipoprotein receptor 1 isoform X1 [Homo sapiens]
GI:290654342 RefSeq XP_009001588.1 181 PREDICTED: oxidized low-density lipoprotein receptor 1 isoform X2 [Callithrix jacchus]
GI:290654342 RefSeq XP_009245725.1 181 PREDICTED: oxidized low-density lipoprotein receptor 1 isoform X3 [Pongo abelii]
GI:290654342 RefSeq XP_010369668.1 181 PREDICTED: oxidized low-density lipoprotein receptor 1 isoform X3 [Rhinopithecus roxellana]