Gene/Proteome Database (LMPD)
Proteins
| synaptotagmin-2 | |
|---|---|
| Refseq ID | NP_033333 |
| Protein GI | 31543797 |
| UniProt ID | P46097 |
| mRNA ID | NM_009307 |
| Length | 422 |
| RefSeq Status | PROVISIONAL |
| MRNIFKRNQEPNVAPATTTATMPLAPVAPADNSTESTGPGESQEDMFAKLKEKFFNEINKIPLPPWALIAMAVVAGLLLLTCCFCICKKCCCKKKKNKKEKGKGMKNAMNMKDMKGGQDDDDAETGLTEGEGEGEEEKEPENLGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKNK | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0030054 | IEA:UniProtKB-KW | C | cell junction |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0005886 | IDA:MGI | C | plasma membrane |
| GO:0008021 | IEA:InterPro | C | synaptic vesicle |
| GO:0005509 | IDA:MGI | F | calcium ion binding |
| GO:0005544 | IDA:MGI | F | calcium-dependent phospholipid binding |
| GO:0005215 | IEA:InterPro | F | transporter activity |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Cofactor | Name=Ca(2+); Xref=ChEBI:CHEBI:29108; Evidence={ECO:0000250}; Note=Binds 3 Ca(2+) ions per subunit. The ions are bound to the C2 domains. {ECO:0000250}; |
| Domain | The first C2 domain mediates Ca(2+)-dependent phospholipid binding. |
| Domain | The second C2 domain mediates interaction with Stonin 2. |
| Function | May have a regulatory role in the membrane interactions during trafficking of synaptic vesicles at the active zone of the synapse. It binds acidic phospholipids with a specificity that requires the presence of both an acidic head group and a diacyl backbone. |
| Interaction | Q8TAC9:SCAMP5 (xeno); NbExp=2; IntAct=EBI-457969, EBI-2695784; O35526:Stx1a; NbExp=2; IntAct=EBI-457969, EBI-400878; |
| Similarity | Belongs to the synaptotagmin family. {ECO:0000305}. |
| Similarity | Contains 2 C2 domains. {ECO:0000255|PROSITE- ProRule:PRU00041}. |
| Subcellular Location | Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Single-pass membrane protein. Cytoplasmic vesicle, secretory vesicle, chromaffin granule membrane; Single-pass membrane protein. Cytoplasm. Note=Synaptic vesicles and chromaffin granules. |
| Subunit | Homotetramer (Probable). Interacts with SCAMP5 (By similarity). Interacts with stonin 2. {ECO:0000250, ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP005784 (as displayed in Record Overview)
Identical Sequences to LMP005784 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:31543797 | DBBJ | BAC29397.1 | 422 | unnamed protein product [Mus musculus] |
| GI:31543797 | GenBank | AAH27019.1 | 422 | Syt2 protein [Mus musculus] |
| GI:31543797 | GenBank | EDL39600.1 | 422 | synaptotagmin II [Mus musculus] |
| GI:31543797 | RefSeq | XP_006529385.1 | 422 | PREDICTED: synaptotagmin-2 isoform X1 [Mus musculus] |
| GI:31543797 | RefSeq | XP_006529386.1 | 422 | PREDICTED: synaptotagmin-2 isoform X2 [Mus musculus] |
Related Sequences to LMP005784 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:31543797 | DBBJ | BAA07041.1 | 422 | synaptotagminII/IP4BP [Mus musculus] |
| GI:31543797 | GenBank | AAF68987.1 | 422 | synaptotagmin II [Mus musculus] |
| GI:31543797 | GenBank | AAF68988.1 | 422 | synaptotagmin II [Mus musculus] |
| GI:31543797 | GenBank | AHH56804.1 | 422 | Sequence 7 from patent US 8617573 |
| GI:31543797 | SwissProt | P29101.1 | 422 | RecName: Full=Synaptotagmin-2; AltName: Full=Synaptotagmin II; Short=SytII [Rattus norvegicus] |
| GI:31543797 | SwissProt | P46097.1 | 422 | RecName: Full=Synaptotagmin-2; AltName: Full=Synaptotagmin II; Short=SytII [Mus musculus] |