Gene/Proteome Database (LMPD)
Proteins
quinone oxidoreductase | |
---|---|
Refseq ID | NP_034098 |
Protein GI | 33859530 |
UniProt ID | P47199 |
mRNA ID | NM_009968 |
Length | 331 |
RefSeq Status | VALIDATED |
MATGQKLMRAIRVFEFGGPEVLKLQSDVVVPVPQSHQVLIKVHACGVNPVETYIRSGAYSRKPALPYTPGSDVAGIIESVGDKVSAFKKGDRVFCYSTVSGGYAEFALAADDTIYPLPETLNFRQGAALGIPYFTACRALFHSARARAGESVLVHGASGGVGLATCQIARAHGLKVLGTAGSEEGKKLVLQNGAHEVFNHKEANYIDKIKMSVGDKDKGVDVIIEMLANENLSNDLKLLSHGGRVVVVGCRGPIEINPRDTMAKETSIIGVSLSSSTKEEFQQFAGLLQAGIEKGWVKPVIGSEYPLEKAAQAHEDIIHGSGKTGKMILLL |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005794 | IEA:Ensembl | C | Golgi apparatus |
GO:0005829 | ISS:UniProtKB | C | cytosol |
GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
GO:0050661 | ISO:MGI | F | NADP binding |
GO:0070402 | ISS:UniProtKB | F | NADPH binding |
GO:0003960 | ISS:UniProtKB | F | NADPH:quinone reductase activity |
GO:0003730 | ISS:UniProtKB | F | mRNA 3'-UTR binding |
GO:0008270 | IEA:InterPro | F | zinc ion binding |
GO:0051289 | IEA:Ensembl | P | protein homotetramerization |
GO:0042178 | ISS:UniProtKB | P | xenobiotic catabolic process |
Domain Information
InterPro Annotations
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Catalytic Activity | NADPH + 2 quinone = NADP(+) + 2 semiquinone. |
Function | Does not have alcohol dehydrogenase activity. Binds NADP and acts through a one-electron transfer process. Orthoquinones, such as 1,2-naphthoquinone or 9,10-phenanthrenequinone, are the best substrates (in vitro). May act in the detoxification of xenobiotics. Interacts with (AU)-rich elements (ARE) in the 3'-UTR of target mRNA species and enhances their stability. NADPH binding interferes with mRNA binding (By similarity). {ECO:0000250}. |
Similarity | Belongs to the zinc-containing alcohol dehydrogenase family. Quinone oxidoreductase subfamily. {ECO:0000305}. |
Subcellular Location | Cytoplasm {ECO:0000250}. |
Subunit | Homotetramer. {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP005931 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
33859530 | RefSeq | NP_034098 | 331 | quinone oxidoreductase |
Identical Sequences to LMP005931 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:33859530 | GenBank | AAB30620.2 | 331 | zeta-crystallin [Mus musculus] |
GI:33859530 | GenBank | EDL11887.1 | 331 | crystallin, zeta, isoform CRA_a [Mus musculus] |
GI:33859530 | GenBank | EDL11889.1 | 331 | crystallin, zeta, isoform CRA_a [Mus musculus] |
GI:33859530 | GenBank | ACJ91544.1 | 331 | Sequence 9 from patent US 7414025 |
GI:33859530 | GenBank | ADR88543.1 | 331 | Sequence 9 from patent US 7741073 |
GI:33859530 | RefSeq | XP_006501036.1 | 331 | PREDICTED: quinone oxidoreductase isoform X1 [Mus musculus] |
Related Sequences to LMP005931 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:33859530 | DBBJ | BAE22081.1 | 331 | unnamed protein product [Mus musculus] |
GI:33859530 | GenBank | AAH03800.1 | 331 | Cryz protein [Mus musculus] |
GI:33859530 | GenBank | AAH43076.1 | 331 | Crystallin, zeta [Mus musculus] |
GI:33859530 | GenBank | EDL11888.1 | 333 | crystallin, zeta, isoform CRA_b, partial [Mus musculus] |
GI:33859530 | GenBank | EDL82539.1 | 329 | rCG28670, isoform CRA_a [Rattus norvegicus] |
GI:33859530 | GenBank | EDL82540.1 | 329 | rCG28670, isoform CRA_a [Rattus norvegicus] |