Gene/Proteome Database (LMPD)
LMPD ID
LMP006044
Gene ID
Species
Homo sapiens (Human)
Gene Name
nudix (nucleoside diphosphate linked moiety X)-type motif 4
Gene Symbol
Synonyms
DIPP2; DIPP2alpha; DIPP2beta
Chromosome
12
Map Location
12q21
EC Number
3.6.1.52
Summary
The protein encoded by this gene regulates the turnover of diphosphoinositol polyphosphates. The turnover of these high-energy diphosphoinositol polyphosphates represents a molecular switching activity with important regulatory consequences. Molecular switching by diphosphoinositol polyphosphates may contribute to regulating intracellular trafficking. Several alternatively spliced transcript variants have been described, but the full-length nature of some variants has not been determined. Isoforms DIPP2alpha and DIPP2beta are distinguishable from each other solely by DIPP2beta possessing one additional amino acid due to intron boundary skidding in alternate splicing. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
| diphosphoinositol polyphosphate phosphohydrolase 2 isoform 3 | |
|---|---|
| Refseq ID | NP_001287951 |
| Protein GI | 666335637 |
| UniProt ID | Q9NZJ9 |
| mRNA ID | NM_001301022 |
| Length | 129 |
| RefSeq Status | REVIEWED |
| MEPEEEPGGAAVREVYEEAGVKGKLGRLLGIFEQNQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSVR | |
| diphosphoinositol polyphosphate phosphohydrolase 2 isoform 4 | |
|---|---|
| Refseq ID | NP_001287952 |
| Protein GI | 666335639 |
| UniProt ID | Q9NZJ9 |
| mRNA ID | NM_001301023 |
| Length | 128 |
| RefSeq Status | REVIEWED |
| MEPEEEPGGAAVREVYEEAGVKGKLGRLLGIFENQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSVR | |
| diphosphoinositol polyphosphate phosphohydrolase 2 isoform 4 | |
|---|---|
| Refseq ID | NP_001287953 |
| Protein GI | 666335641 |
| UniProt ID | Q9NZJ9 |
| mRNA ID | NM_001301024 |
| Length | 128 |
| RefSeq Status | REVIEWED |
| Protein sequence is identical to GI:666335639 (mRNA isoform) | |
| diphosphoinositol polyphosphate phosphohydrolase 2 isoform alpha | |
|---|---|
| Refseq ID | NP_061967 |
| Protein GI | 40317632 |
| UniProt ID | Q9NZJ9 |
| mRNA ID | NM_019094 |
| Length | 180 |
| RefSeq Status | REVIEWED |
| MMKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGIFENQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSVR | |
| diphosphoinositol polyphosphate phosphohydrolase 2 isoform beta | |
|---|---|
| Refseq ID | NP_950241 |
| Protein GI | 40317634 |
| UniProt ID | Q9NZJ9 |
| mRNA ID | NM_199040 |
| Length | 181 |
| RefSeq Status | REVIEWED |
| MMKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGIFEQNQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSVR | |
Gene Information
Entrez Gene ID
Gene Name
nudix (nucleoside diphosphate linked moiety X)-type motif 4
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005829 | TAS:Reactome | C | cytosol |
| GO:0005622 | TAS:UniProtKB | C | intracellular |
| GO:0008486 | IDA:UniProtKB | F | diphosphoinositol-polyphosphate diphosphatase activity |
| GO:0052840 | TAS:Reactome | F | inositol diphosphate tetrakisphosphate diphosphatase activity |
| GO:0052846 | IEA:UniProtKB-EC | F | inositol-1,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 1-diphosphatase activity |
| GO:0052847 | IEA:UniProtKB-EC | F | inositol-1,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 5-diphosphatase activity |
| GO:0052843 | IEA:UniProtKB-EC | F | inositol-1-diphosphate-2,3,4,5,6-pentakisphosphate diphosphatase activity |
| GO:0052848 | IEA:UniProtKB-EC | F | inositol-3,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 5-diphosphatase activity |
| GO:0052844 | IEA:UniProtKB-EC | F | inositol-3-diphosphate-1,2,4,5,6-pentakisphosphate diphosphatase activity |
| GO:0052845 | IEA:UniProtKB-EC | F | inositol-5-diphosphate-1,2,3,4,6-pentakisphosphate diphosphatase activity |
| GO:0046872 | IEA:UniProtKB-KW | F | metal ion binding |
| GO:0030515 | ISS:UniProtKB | F | snoRNA binding |
| GO:0019722 | TAS:UniProtKB | P | calcium-mediated signaling |
| GO:0009187 | TAS:ProtInc | P | cyclic nucleotide metabolic process |
| GO:0019935 | TAS:UniProtKB | P | cyclic-nucleotide-mediated signaling |
| GO:0043647 | TAS:Reactome | P | inositol phosphate metabolic process |
| GO:0035556 | NAS:UniProtKB | P | intracellular signal transduction |
| GO:0046907 | TAS:UniProtKB | P | intracellular transport |
| GO:0046831 | TAS:UniProtKB | P | regulation of RNA export from nucleus |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_150154 | Inositol phosphate metabolism |
| REACT_111217 | Metabolism |
| REACT_150188 | Synthesis of pyrophosphates in the cytosol |
Domain Information
UniProt Annotations
Entry Information
Gene Name
nudix (nucleoside diphosphate linked moiety X)-type motif 4
Protein Entry
Q9NZJ9_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=3; Name=1; Synonyms=Alpha, DIPP2alpha; IsoId=Q9NZJ9-1; Sequence=Displayed; Name=2; Synonyms=Beta, DIPP2beta; IsoId=Q9NZJ9-2; Sequence=VSP_014270; Name=3; IsoId=Q9NZJ9-3; Sequence=VSP_014269, VSP_014270; |
| Biophysicochemical Properties | Kinetic parameters: KM=4.2 nM for PP-InsP5 ; |
| Catalytic Activity | Diphospho-myo-inositol polyphosphate + H(2)O = myo-inositol polyphosphate + phosphate. |
| Cofactor | Name=Mg(2+); Xref=ChEBI |
| Function | Cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate), PP-InsP4 and [PP]2-InsP4 (bisdiphosphoinositol tetrakisphosphate), suggesting that it may play a role in signal transduction. Also able to catalyze the hydrolysis of dinucleoside oligophosphate Ap6A, but not Ap5A. The major reaction products are ADP and p4a from Ap6A. Also able to hydrolyze 5-phosphoribose 1-diphosphate. Does not play a role in U8 snoRNA decapping activity. Binds U8 snoRNA. |
| Sequence Caution | Sequence=AAF75563.1; Type=Erroneous termination; Positions=181; Note=Translated as stop.; Evidence= ; Sequence=BAE16985.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ; |
| Similarity | Belongs to the Nudix hydrolase family. DIPP subfamily. |
| Similarity | Contains 1 nudix hydrolase domain. |
| Subcellular Location | Cytoplasm . |
| Tissue Specificity | Expressed in heart and, at lower level in skeletal muscle, pancreas and kidney. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006044 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 666335637 | RefSeq | NP_001287951 | 129 | diphosphoinositol polyphosphate phosphohydrolase 2 isoform 3 |
| 666335639 | RefSeq | NP_001287952 | 128 | diphosphoinositol polyphosphate phosphohydrolase 2 isoform 4 |
| 40317632 | RefSeq | NP_061967 | 180 | diphosphoinositol polyphosphate phosphohydrolase 2 isoform alpha |
| 40317634 | RefSeq | NP_950241 | 181 | diphosphoinositol polyphosphate phosphohydrolase 2 isoform beta |
Identical Sequences to LMP006044 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:666335637 | DBBJ | BAH14152.1 | 129 | unnamed protein product [Homo sapiens] |
| GI:666335639 | EMBL | CAH18283.1 | 128 | hypothetical protein [Homo sapiens] |
| GI:40317634 | GenBank | ABM86320.1 | 181 | nudix (nucleoside diphosphate linked moiety X)-type motif 4, partial [synthetic construct] |
| GI:40317632 | GenBank | JAA18657.1 | 180 | nudix (nucleoside diphosphate linked moiety X)-type motif 4 [Pan troglodytes] |
| GI:40317632 | GenBank | JAA26408.1 | 180 | nudix (nucleoside diphosphate linked moiety X)-type motif 4 [Pan troglodytes] |
| GI:40317632 | GenBank | JAA26409.1 | 180 | nudix (nucleoside diphosphate linked moiety X)-type motif 4 [Pan troglodytes] |
| GI:40317632 | GenBank | JAA38441.1 | 180 | nudix (nucleoside diphosphate linked moiety X)-type motif 4 [Pan troglodytes] |
| GI:40317632 | GenBank | JAA38442.1 | 180 | nudix (nucleoside diphosphate linked moiety X)-type motif 4 [Pan troglodytes] |
| GI:40317632 | GenBank | AHD69587.1 | 180 | Sequence 601 from patent US 8586006 |
| GI:40317634 | GenBank | AHD69588.1 | 181 | Sequence 602 from patent US 8586006 |
| GI:40317634 | RefSeq | XP_003259711.1 | 181 | PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 2 [Nomascus leucogenys] |
| GI:40317634 | RefSeq | XP_001136251.2 | 181 | PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 2 isoform X1 [Pan troglodytes] |
| GI:666335637 | RefSeq | XP_003816921.1 | 129 | PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 2 [Pan paniscus] |
| GI:40317634 | RefSeq | XP_004053722.1 | 181 | PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 2 [Gorilla gorilla gorilla] |
| GI:666335639 | RefSeq | NP_001287953.1 | 128 | diphosphoinositol polyphosphate phosphohydrolase 2 isoform 4 [Homo sapiens] |
| GI:666335637 | RefSeq | XP_008968230.1 | 129 | PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 2 [Pan paniscus] |
| GI:40317634 | RefSeq | XP_009246373.1 | 181 | PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 2 isoform X1 [Pongo abelii] |
| GI:666335637 | RefSeq | XP_009246374.1 | 129 | PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 2 isoform X2 [Pongo abelii] |
| GI:666335637 | RefSeq | XP_009424268.1 | 129 | PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 2 isoform X2 [Pan troglodytes] |
| GI:666335639 | RefSeq | XP_009424269.1 | 128 | PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 2 isoform X3 [Pan troglodytes] |
Related Sequences to LMP006044 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:40317634 | DBBJ | BAD97217.1 | 181 | nudix (nucleoside diphosphate linked moiety X)-type motif 4 isoform beta variant, partial [Homo sapiens] |
| GI:40317632 | GenBank | AAV38910.1 | 181 | nudix (nucleoside diphosphate linked moiety X)-type motif 4, partial [synthetic construct] |
| GI:40317632 | GenBank | AAV38911.1 | 181 | nudix (nucleoside diphosphate linked moiety X)-type motif 4, partial [synthetic construct] |
| GI:666335637 | GenBank | AAV38913.1 | 181 | nudix (nucleoside diphosphate linked moiety X)-type motif 4 [Homo sapiens] |
| GI:40317632 | GenBank | AAX36806.1 | 181 | nudix-type motif 4, partial [synthetic construct] |
| GI:666335637 | GenBank | AAX41388.1 | 181 | nudix-type motif 4 [synthetic construct] |
| GI:40317632 | GenBank | AAX43010.1 | 181 | nudix-type motif 4, partial [synthetic construct] |
| GI:40317632 | GenBank | AAX43011.1 | 181 | nudix-type motif 4, partial [synthetic construct] |
| GI:40317632 | GenBank | AAX43162.1 | 181 | nudix-type motif 4, partial [synthetic construct] |
| GI:666335637 | GenBank | EAW97476.1 | 181 | nudix (nucleoside diphosphate linked moiety X)-type motif 4, isoform CRA_b [Homo sapiens] |
| GI:666335637 | GenBank | EAW97479.1 | 181 | nudix (nucleoside diphosphate linked moiety X)-type motif 4, isoform CRA_b [Homo sapiens] |
| GI:666335639 | GenBank | JAA08035.1 | 180 | nudix (nucleoside diphosphate linked moiety X)-type motif 4 [Pan troglodytes] |
| GI:666335639 | GenBank | JAA18657.1 | 180 | nudix (nucleoside diphosphate linked moiety X)-type motif 4 [Pan troglodytes] |
| GI:666335639 | GenBank | JAA26408.1 | 180 | nudix (nucleoside diphosphate linked moiety X)-type motif 4 [Pan troglodytes] |
| GI:666335639 | GenBank | JAA26409.1 | 180 | nudix (nucleoside diphosphate linked moiety X)-type motif 4 [Pan troglodytes] |
| GI:666335639 | GenBank | JAA38441.1 | 180 | nudix (nucleoside diphosphate linked moiety X)-type motif 4 [Pan troglodytes] |
| GI:666335639 | GenBank | JAA38442.1 | 180 | nudix (nucleoside diphosphate linked moiety X)-type motif 4 [Pan troglodytes] |
| GI:40317634 | RefSeq | XP_002752935.1 | 181 | PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 2 isoform X1 [Callithrix jacchus] |
| GI:666335637 | RefSeq | XP_003259711.1 | 181 | PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 2 [Nomascus leucogenys] |
| GI:666335637 | RefSeq | XP_001136251.2 | 181 | PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 2 isoform X1 [Pan troglodytes] |
| GI:40317634 | RefSeq | XP_003927933.1 | 181 | PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 2 [Saimiri boliviensis boliviensis] |
| GI:40317634 | RefSeq | XP_005571916.1 | 181 | PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 2 isoform X1 [Macaca fascicularis] |
| GI:40317634 | RefSeq | XP_008002433.1 | 181 | PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 2 isoform X1 [Chlorocebus sabaeus] |
| GI:40317634 | RefSeq | XP_010382236.1 | 181 | PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 2 [Rhinopithecus roxellana] |