Gene/Proteome Database (LMPD)

LMPD ID
LMP006044
Gene ID
11163
Species
Homo sapiens (Human)
Gene Name
nudix (nucleoside diphosphate linked moiety X)-type motif 4
Gene Symbol
NUDT4
Synonyms
DIPP2; DIPP2alpha; DIPP2beta
Chromosome
12
Map Location
12q21
EC Number
3.6.1.52
Summary
The protein encoded by this gene regulates the turnover of diphosphoinositol polyphosphates. The turnover of these high-energy diphosphoinositol polyphosphates represents a molecular switching activity with important regulatory consequences. Molecular switching by diphosphoinositol polyphosphates may contribute to regulating intracellular trafficking. Several alternatively spliced transcript variants have been described, but the full-length nature of some variants has not been determined. Isoforms DIPP2alpha and DIPP2beta are distinguishable from each other solely by DIPP2beta possessing one additional amino acid due to intron boundary skidding in alternate splicing. [provided by RefSeq, Jul 2008]
Orthologs
View orthologs and multiple alignments for NUDT4

Proteins

diphosphoinositol polyphosphate phosphohydrolase 2 isoform 3
Refseq ID NP_001287951
Protein GI 666335637
UniProt ID Q9NZJ9
mRNA ID NM_001301022
Length 129
RefSeq Status REVIEWED
MEPEEEPGGAAVREVYEEAGVKGKLGRLLGIFEQNQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSVR
diphosphoinositol polyphosphate phosphohydrolase 2 isoform 4
Refseq ID NP_001287952
Protein GI 666335639
UniProt ID Q9NZJ9
mRNA ID NM_001301023
Length 128
RefSeq Status REVIEWED
MEPEEEPGGAAVREVYEEAGVKGKLGRLLGIFENQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSVR
diphosphoinositol polyphosphate phosphohydrolase 2 isoform 4
Refseq ID NP_001287953
Protein GI 666335641
UniProt ID Q9NZJ9
mRNA ID NM_001301024
Length 128
RefSeq Status REVIEWED
Protein sequence is identical to GI:666335639 (mRNA isoform)
diphosphoinositol polyphosphate phosphohydrolase 2 isoform alpha
Refseq ID NP_061967
Protein GI 40317632
UniProt ID Q9NZJ9
mRNA ID NM_019094
Length 180
RefSeq Status REVIEWED
MMKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGIFENQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSVR
diphosphoinositol polyphosphate phosphohydrolase 2 isoform beta
Refseq ID NP_950241
Protein GI 40317634
UniProt ID Q9NZJ9
mRNA ID NM_199040
Length 181
RefSeq Status REVIEWED
MMKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGIFEQNQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSVR

Gene Information

Entrez Gene ID
11163
Gene Name
nudix (nucleoside diphosphate linked moiety X)-type motif 4
Gene Symbol
NUDT4
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005829 TAS:Reactome C cytosol
GO:0005622 TAS:UniProtKB C intracellular
GO:0008486 IDA:UniProtKB F diphosphoinositol-polyphosphate diphosphatase activity
GO:0052840 TAS:Reactome F inositol diphosphate tetrakisphosphate diphosphatase activity
GO:0052846 IEA:UniProtKB-EC F inositol-1,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 1-diphosphatase activity
GO:0052847 IEA:UniProtKB-EC F inositol-1,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 5-diphosphatase activity
GO:0052843 IEA:UniProtKB-EC F inositol-1-diphosphate-2,3,4,5,6-pentakisphosphate diphosphatase activity
GO:0052848 IEA:UniProtKB-EC F inositol-3,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 5-diphosphatase activity
GO:0052844 IEA:UniProtKB-EC F inositol-3-diphosphate-1,2,4,5,6-pentakisphosphate diphosphatase activity
GO:0052845 IEA:UniProtKB-EC F inositol-5-diphosphate-1,2,3,4,6-pentakisphosphate diphosphatase activity
GO:0046872 IEA:UniProtKB-KW F metal ion binding
GO:0030515 ISS:UniProtKB F snoRNA binding
GO:0019722 TAS:UniProtKB P calcium-mediated signaling
GO:0009187 TAS:ProtInc P cyclic nucleotide metabolic process
GO:0019935 TAS:UniProtKB P cyclic-nucleotide-mediated signaling
GO:0043647 TAS:Reactome P inositol phosphate metabolic process
GO:0035556 NAS:UniProtKB P intracellular signal transduction
GO:0046907 TAS:UniProtKB P intracellular transport
GO:0046831 TAS:UniProtKB P regulation of RNA export from nucleus
GO:0044281 TAS:Reactome P small molecule metabolic process

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_150154 Inositol phosphate metabolism
REACT_111217 Metabolism
REACT_150188 Synthesis of pyrophosphates in the cytosol

Domain Information

InterPro Annotations

Accession Description
IPR000086 NUDIX hydrolase domain
IPR015797 NUDIX hydrolase domain-like
IPR020084 NUDIX hydrolase, conserved site

UniProt Annotations

Entry Information

Gene Name
nudix (nucleoside diphosphate linked moiety X)-type motif 4
Protein Entry
Q9NZJ9_HUMAN
UniProt ID
Q9NZJ9
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=3; Name=1; Synonyms=Alpha, DIPP2alpha; IsoId=Q9NZJ9-1; Sequence=Displayed; Name=2; Synonyms=Beta, DIPP2beta; IsoId=Q9NZJ9-2; Sequence=VSP_014270; Name=3; IsoId=Q9NZJ9-3; Sequence=VSP_014269, VSP_014270;
Biophysicochemical Properties Kinetic parameters: KM=4.2 nM for PP-InsP5 ;
Catalytic Activity Diphospho-myo-inositol polyphosphate + H(2)O = myo-inositol polyphosphate + phosphate.
Cofactor Name=Mg(2+); Xref=ChEBI
Function Cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate), PP-InsP4 and [PP]2-InsP4 (bisdiphosphoinositol tetrakisphosphate), suggesting that it may play a role in signal transduction. Also able to catalyze the hydrolysis of dinucleoside oligophosphate Ap6A, but not Ap5A. The major reaction products are ADP and p4a from Ap6A. Also able to hydrolyze 5-phosphoribose 1-diphosphate. Does not play a role in U8 snoRNA decapping activity. Binds U8 snoRNA.
Sequence Caution Sequence=AAF75563.1; Type=Erroneous termination; Positions=181; Note=Translated as stop.; Evidence= ; Sequence=BAE16985.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ;
Similarity Belongs to the Nudix hydrolase family. DIPP subfamily.
Similarity Contains 1 nudix hydrolase domain.
Subcellular Location Cytoplasm .
Tissue Specificity Expressed in heart and, at lower level in skeletal muscle, pancreas and kidney.

Identical and Related Proteins

Unique RefSeq proteins for LMP006044 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
666335637 RefSeq NP_001287951 129 diphosphoinositol polyphosphate phosphohydrolase 2 isoform 3
666335639 RefSeq NP_001287952 128 diphosphoinositol polyphosphate phosphohydrolase 2 isoform 4
40317632 RefSeq NP_061967 180 diphosphoinositol polyphosphate phosphohydrolase 2 isoform alpha
40317634 RefSeq NP_950241 181 diphosphoinositol polyphosphate phosphohydrolase 2 isoform beta

Identical Sequences to LMP006044 proteins

Reference Database Accession Length Protein Name
GI:666335637 DBBJ BAH14152.1 129 unnamed protein product [Homo sapiens]
GI:666335639 EMBL CAH18283.1 128 hypothetical protein [Homo sapiens]
GI:40317634 GenBank ABM86320.1 181 nudix (nucleoside diphosphate linked moiety X)-type motif 4, partial [synthetic construct]
GI:40317632 GenBank JAA18657.1 180 nudix (nucleoside diphosphate linked moiety X)-type motif 4 [Pan troglodytes]
GI:40317632 GenBank JAA26408.1 180 nudix (nucleoside diphosphate linked moiety X)-type motif 4 [Pan troglodytes]
GI:40317632 GenBank JAA26409.1 180 nudix (nucleoside diphosphate linked moiety X)-type motif 4 [Pan troglodytes]
GI:40317632 GenBank JAA38441.1 180 nudix (nucleoside diphosphate linked moiety X)-type motif 4 [Pan troglodytes]
GI:40317632 GenBank JAA38442.1 180 nudix (nucleoside diphosphate linked moiety X)-type motif 4 [Pan troglodytes]
GI:40317632 GenBank AHD69587.1 180 Sequence 601 from patent US 8586006
GI:40317634 GenBank AHD69588.1 181 Sequence 602 from patent US 8586006
GI:40317634 RefSeq XP_003259711.1 181 PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 2 [Nomascus leucogenys]
GI:40317634 RefSeq XP_001136251.2 181 PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 2 isoform X1 [Pan troglodytes]
GI:666335637 RefSeq XP_003816921.1 129 PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 2 [Pan paniscus]
GI:40317634 RefSeq XP_004053722.1 181 PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 2 [Gorilla gorilla gorilla]
GI:666335639 RefSeq NP_001287953.1 128 diphosphoinositol polyphosphate phosphohydrolase 2 isoform 4 [Homo sapiens]
GI:666335637 RefSeq XP_008968230.1 129 PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 2 [Pan paniscus]
GI:40317634 RefSeq XP_009246373.1 181 PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 2 isoform X1 [Pongo abelii]
GI:666335637 RefSeq XP_009246374.1 129 PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 2 isoform X2 [Pongo abelii]
GI:666335637 RefSeq XP_009424268.1 129 PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 2 isoform X2 [Pan troglodytes]
GI:666335639 RefSeq XP_009424269.1 128 PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 2 isoform X3 [Pan troglodytes]

Related Sequences to LMP006044 proteins

Reference Database Accession Length Protein Name
GI:40317634 DBBJ BAD97217.1 181 nudix (nucleoside diphosphate linked moiety X)-type motif 4 isoform beta variant, partial [Homo sapiens]
GI:40317632 GenBank AAV38910.1 181 nudix (nucleoside diphosphate linked moiety X)-type motif 4, partial [synthetic construct]
GI:40317632 GenBank AAV38911.1 181 nudix (nucleoside diphosphate linked moiety X)-type motif 4, partial [synthetic construct]
GI:666335637 GenBank AAV38913.1 181 nudix (nucleoside diphosphate linked moiety X)-type motif 4 [Homo sapiens]
GI:40317632 GenBank AAX36806.1 181 nudix-type motif 4, partial [synthetic construct]
GI:666335637 GenBank AAX41388.1 181 nudix-type motif 4 [synthetic construct]
GI:40317632 GenBank AAX43010.1 181 nudix-type motif 4, partial [synthetic construct]
GI:40317632 GenBank AAX43011.1 181 nudix-type motif 4, partial [synthetic construct]
GI:40317632 GenBank AAX43162.1 181 nudix-type motif 4, partial [synthetic construct]
GI:666335637 GenBank EAW97476.1 181 nudix (nucleoside diphosphate linked moiety X)-type motif 4, isoform CRA_b [Homo sapiens]
GI:666335637 GenBank EAW97479.1 181 nudix (nucleoside diphosphate linked moiety X)-type motif 4, isoform CRA_b [Homo sapiens]
GI:666335639 GenBank JAA08035.1 180 nudix (nucleoside diphosphate linked moiety X)-type motif 4 [Pan troglodytes]
GI:666335639 GenBank JAA18657.1 180 nudix (nucleoside diphosphate linked moiety X)-type motif 4 [Pan troglodytes]
GI:666335639 GenBank JAA26408.1 180 nudix (nucleoside diphosphate linked moiety X)-type motif 4 [Pan troglodytes]
GI:666335639 GenBank JAA26409.1 180 nudix (nucleoside diphosphate linked moiety X)-type motif 4 [Pan troglodytes]
GI:666335639 GenBank JAA38441.1 180 nudix (nucleoside diphosphate linked moiety X)-type motif 4 [Pan troglodytes]
GI:666335639 GenBank JAA38442.1 180 nudix (nucleoside diphosphate linked moiety X)-type motif 4 [Pan troglodytes]
GI:40317634 RefSeq XP_002752935.1 181 PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 2 isoform X1 [Callithrix jacchus]
GI:666335637 RefSeq XP_003259711.1 181 PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 2 [Nomascus leucogenys]
GI:666335637 RefSeq XP_001136251.2 181 PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 2 isoform X1 [Pan troglodytes]
GI:40317634 RefSeq XP_003927933.1 181 PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 2 [Saimiri boliviensis boliviensis]
GI:40317634 RefSeq XP_005571916.1 181 PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 2 isoform X1 [Macaca fascicularis]
GI:40317634 RefSeq XP_008002433.1 181 PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 2 isoform X1 [Chlorocebus sabaeus]
GI:40317634 RefSeq XP_010382236.1 181 PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 2 [Rhinopithecus roxellana]