Gene/Proteome Database (LMPD)
LMPD ID
LMP006053
Gene ID
Species
Homo sapiens (Human)
Gene Name
zinc finger, DHHC-type containing 9
Gene Symbol
Synonyms
CGI89; CXorf11; DHHC9; MMSA1; MRXSZ; ZDHHC10; ZNF379; ZNF380
Alternate Names
palmitoyltransferase ZDHHC9; antigen MMSA-1; zinc finger protein 379; zinc finger protein 380; zinc finger, DHHC domain containing 10; Asp-His-His-Cys domain containing protein 9
Chromosome
X
Map Location
Xq26.1
EC Number
2.3.1.225
Summary
This gene encodes an integral membrane protein that is a member of the zinc finger DHHC domain-containing protein family. The encoded protein forms a complex with golgin subfamily A member 7 and functions as a palmitoyltransferase. This protein specifically palmitoylates HRAS and NRAS. Mutations in this gene are associated with X-linked mental retardation. Alternate splicing results in multiple transcript variants that encode the same protein.[provided by RefSeq, May 2010]
Orthologs
Proteins
| palmitoyltransferase ZDHHC9 | |
|---|---|
| Refseq ID | NP_057116 |
| Protein GI | 56682972 |
| UniProt ID | Q9Y397 |
| mRNA ID | NM_016032 |
| Length | 364 |
| RefSeq Status | REVIEWED |
| MSVMVVRKKVTRKWEKLPGRNTFCCDGRVMMARQKGIFYLTLFLILGTCTLFFAFECRYLAVQLSPAIPVFAAMLFLFSMATLLRTSFSDPGVIPRALPDEAAFIEMEIEATNGAVPQGQRPPPRIKNFQINNQIVKLKYCYTCKIFRPPRASHCSICDNCVERFDHHCPWVGNCVGKRNYRYFYLFILSLSLLTIYVFAFNIVYVALKSLKIGFLETLKETPGTVLEVLICFFTLWSVVGLTGFHTFLVALNQTTNEDIKGSWTGKNRVQNPYSHGNIVKNCCEVLCGPLPPSVLDRRGILPLEESGSRPPSTQETSSSLLPQSPAPTEHLNSNEMPEDSSTPEEMPPPEPPEPPQEAAEAEK | |
| palmitoyltransferase ZDHHC9 | |
|---|---|
| Refseq ID | NP_001008223 |
| Protein GI | 56682974 |
| UniProt ID | Q9Y397 |
| mRNA ID | NM_001008222 |
| Length | 364 |
| RefSeq Status | REVIEWED |
| Protein sequence is identical to GI:56682972 (mRNA isoform) | |
Gene Information
Entrez Gene ID
Gene Name
zinc finger, DHHC-type containing 9
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IDA:HPA | C | cytoplasm |
| GO:0005783 | IDA:UniProt | C | endoplasmic reticulum |
| GO:0005794 | IDA:UniProt | C | Golgi apparatus |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0031228 | IDA:UniProt | C | intrinsic component of Golgi membrane |
| GO:0002178 | IDA:UniProt | C | palmitoyltransferase complex |
| GO:0016409 | IDA:UniProt | F | palmitoyltransferase activity |
| GO:0019706 | IEA:UniProtKB-EC | F | protein-cysteine S-palmitoyltransferase activity |
| GO:0043849 | IDA:UniProt | F | Ras palmitoyltransferase activity |
| GO:0008270 | IEA:InterPro | F | zinc ion binding |
| GO:0018230 | IDA:UniProt | P | peptidyl-L-cysteine S-palmitoylation |
| GO:0018345 | IDA:UniProt | P | protein palmitoylation |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001594 | Zinc finger, DHHC-type, palmitoyltransferase |
UniProt Annotations
Entry Information
Gene Name
zinc finger, DHHC-type containing 9
Protein Entry
ZDHC9_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA. |
| Disease | Mental retardation, X-linked, syndromic, ZDHHC9-related (MRXSZ) [MIM |
| Domain | The DHHC domain is required for palmitoyltransferase activity. |
| Function | The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS. |
| Sequence Caution | Sequence=AAD34084.1; Type=Erroneous initiation; Evidence= ; Sequence=BAA91683.1; Type=Erroneous initiation; Evidence= ; Sequence=BAD93044.1; Type=Erroneous initiation; Evidence= ; Sequence=CAB82308.1; Type=Erroneous initiation; Evidence= ; |
| Similarity | Belongs to the DHHC palmitoyltransferase family. ERF2/ZDHHC9 subfamily. |
| Similarity | Contains 1 DHHC-type zinc finger. |
| Subcellular Location | Endoplasmic reticulum membrane ; Multi-pass membrane protein . Golgi apparatus membrane ; Multi-pass membrane protein . |
| Subunit | Interacts with GOLGA7. |
| Tissue Specificity | Highly expressed in kidney, skeletal muscle, brain, lung and liver. Absent in thymus, spleen and leukocytes. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006053 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 56682972 | RefSeq | NP_057116 | 364 | palmitoyltransferase ZDHHC9 |
Identical Sequences to LMP006053 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:56682972 | GenBank | JAB38345.1 | 364 | palmitoyltransferase ZDHHC9 [Callithrix jacchus] |
| GI:56682972 | GenBank | JAB45476.1 | 364 | palmitoyltransferase ZDHHC9 [Callithrix jacchus] |
| GI:56682972 | GenBank | AHD76044.1 | 364 | Sequence 18427 from patent US 8586006 |
| GI:56682972 | GenBank | AHD76045.1 | 364 | Sequence 18428 from patent US 8586006 |
| GI:56682972 | GenBank | AIC51404.1 | 364 | ZDHHC9, partial [synthetic construct] |
| GI:56682972 | RefSeq | XP_008970593.1 | 364 | PREDICTED: palmitoyltransferase ZDHHC9 isoform X1 [Pan paniscus] |
Related Sequences to LMP006053 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:56682972 | DBBJ | BAD93044.1 | 389 | zinc finger, DHHC domain containing 9 variant, partial [Homo sapiens] |
| GI:56682972 | EMBL | CAB82308.1 | 381 | hypothetical protein, partial [Homo sapiens] |
| GI:56682972 | GenBank | EHH61213.1 | 364 | Palmitoyltransferase ZDHHC9 [Macaca fascicularis] |
| GI:56682972 | PIR | - | 381 | hypothetical protein DKFZp761E1347.1 - human (fragment) [Homo sapiens] |
| GI:56682972 | RefSeq | XP_003918308.1 | 364 | PREDICTED: palmitoyltransferase ZDHHC9 [Papio anubis] |
| GI:56682972 | RefSeq | XP_010353095.1 | 364 | PREDICTED: palmitoyltransferase ZDHHC9 [Rhinopithecus roxellana] |