Gene/Proteome Database (LMPD)
LMPD ID
LMP006065
Gene ID
Species
Mus musculus (Mouse)
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class L
Gene Symbol
Synonyms
Gm737
Alternate Names
N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase; PIG-L; phosphatidylinositol glycan, class L; phosphatidylinositol-glycan biosynthesis class L protein; ortholog of human and rat phosphatidylinositol glycan class L PIGL
Chromosome
11
Map Location
11 B2|11
EC Number
3.5.1.89
Proteins
N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase | |
---|---|
Refseq ID | NP_001034625 |
Protein GI | 88014552 |
UniProt ID | Q5SX19 |
mRNA ID | NM_001039536 |
Length | 252 |
RefSeq Status | PROVISIONAL |
MELVGFLCVAVAVLTWGFLRVWNSAERMRSPEQAGLPGAGSRALVVIAHPDDEAMFFAPTMLGLARLEQQVSLLCFSSGNYYNQGEIRKKELLQSCAVLGIPPSRVMIIDKRDFPDDPEVQWDTELVASTLLQHIHANGTDLVVTFDAEGVSGHSNHIALYKAVRALHSGGKLPKGCSVLTLQSVNALRKYAFLLDLPWTLLSPQDVLFVLTSKEVAQAKKAMSCHRSQLLWFRYLYVLFSRYMRINSLRFL |
Gene Information
Entrez Gene ID
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class L
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0000225 | IEA:UniProtKB-EC | F | N-acetylglucosaminylphosphatidylinositol deacetylase activity |
GO:0006506 | IEA:UniProtKB-UniPathway | P | GPI anchor biosynthetic process |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
mmu00563 | Glycosylphosphatidylinositol(GPI)-anchor biosynthesis |
mmu01100 | Metabolic pathways |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
5893244 | Synthesis of glycosylphosphatidylinositol (GPI) |
Domain Information
UniProt Annotations
Entry Information
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class L
Protein Entry
PIGL_MOUSE
UniProt ID
Species
Mouse
Comments
Comment Type | Description |
---|---|
Catalytic Activity | 6-(N-acetyl-alpha-D-glucosaminyl)-1- phosphatidyl-1D-myo-inositol + H(2)O = 6-(alpha-D-glucosaminyl)-1- phosphatidyl-1D-myo-inositol + acetate. |
Function | Involved in the second step of GPI biosynthesis. De-N- acetylation of N-acetylglucosaminyl-phosphatidylinositol (By similarity). {ECO:0000250}. |
Pathway | Glycolipid biosynthesis; glycosylphosphatidylinositol- anchor biosynthesis. |
Similarity | Belongs to the PIGL family. {ECO:0000305}. |
Subcellular Location | Endoplasmic reticulum membrane {ECO:0000250}; Single-pass membrane protein {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006065 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
88014552 | RefSeq | NP_001034625 | 252 | N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase |
Identical Sequences to LMP006065 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:88014552 | DBBJ | BAE34385.1 | 252 | unnamed protein product [Mus musculus] |
GI:88014552 | GenBank | EDL10346.1 | 252 | mCG23380, isoform CRA_b [Mus musculus] |
GI:88014552 | SwissProt | Q5SX19.1 | 252 | RecName: Full=N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase; AltName: Full=Phosphatidylinositol-glycan biosynthesis class L protein; Short=PIG-L [Mus musculus] |
Related Sequences to LMP006065 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:88014552 | DBBJ | BAA20869.1 | 252 | PIG-L [Rattus norvegicus] |
GI:88014552 | GenBank | AAH74020.1 | 252 | Pigl protein [Rattus norvegicus] |
GI:88014552 | GenBank | EDM04707.1 | 252 | phosphatidylinositol glycan, class L [Rattus norvegicus] |
GI:88014552 | GenBank | AED45473.1 | 285 | Sequence 1239 from patent US 7892730 |
GI:88014552 | RefSeq | NP_620256.1 | 252 | N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase [Rattus norvegicus] |
GI:88014552 | SwissProt | O35790.1 | 252 | RecName: Full=N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase; AltName: Full=Phosphatidylinositol-glycan biosynthesis class L protein; Short=PIG-L [Rattus norvegicus] |