Gene/Proteome Database (LMPD)

LMPD ID
LMP006108
Gene ID
67381
Species
Mus musculus (Mouse)
Gene Name
mediator complex subunit 4
Gene Symbol
Med4
Synonyms
2410046H15Rik; DRIP36; HSPC126; TRAP36; Vdirp; Vdrip
Alternate Names
mediator of RNA polymerase II transcription subunit 4; p36 TRAP/SMCC/PC2 subunit; vitamin D receptor interacting protein; mediator of RNA polymerase II transcription, subunit 4 homolog
Chromosome
14
Map Location
14 D3|14

Proteins

mediator of RNA polymerase II transcription subunit 4
Refseq ID NP_080395
Protein GI 13385626
UniProt ID Q9CQA5
mRNA ID NM_026119
Length 270
RefSeq Status PROVISIONAL
MAASSSGEKEKERMGGVSGMAGLGSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQLEEENQVLELLIHRDGDFQELMKLALNQGKVHHEMQALEKEVEKRDSDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARKGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTSGVNGHLPGDALAAGRLPDVLAPQYPWQSNDMSVNMLPPNHSSDFLLEPPGHNKENEDDVEVMSTDSSSSSSDSD

Gene Information

Entrez Gene ID
67381
Gene Name
mediator complex subunit 4
Gene Symbol
Med4
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016592 IDA:MGI C mediator complex
GO:0005654 TAS:Reactome C nucleoplasm
GO:0001104 IEA:Ensembl F RNA polymerase II transcription cofactor activity
GO:0004872 IEA:Ensembl F receptor activity
GO:0030521 IEA:Ensembl P androgen receptor signaling pathway
GO:0045893 IEA:Ensembl P positive regulation of transcription, DNA-templated
GO:0006367 IEA:Ensembl P transcription initiation from RNA polymerase II promoter

KEGG Pathway Links

KEGG Pathway ID Description
mmu04919 Thyroid hormone signaling pathway

REACTOME Pathway Links

REACTOME Pathway ID Description
5893843 PPARA activates gene expression
442533 Transcriptional Regulation of Adipocyte Differentiation in 3T3-L1 Pre-adipocytes
5893677 Transcriptional regulation of white adipocyte differentiation

Domain Information

InterPro Annotations

Accession Description
IPR019258 Mediator complex, subunit Med4

UniProt Annotations

Entry Information

Gene Name
mediator complex subunit 4
Protein Entry
MED4_MOUSE
UniProt ID
Q9CQA5
Species
Mouse

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9CQA5-1; Sequence=Displayed; Name=2; IsoId=Q9CQA5-2; Sequence=VSP_027918, VSP_027919; Note=No experimental confirmation available.;
Function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity). {ECO:0000250}.
Sequence Caution Sequence=BAE26554.1; Type=Erroneous initiation; Evidence={ECO:0000305};
Similarity Belongs to the Mediator complex subunit 4 family. {ECO:0000305}.
Subcellular Location Nucleus {ECO:0000250}.
Subunit Component of the Mediator complex, which is composed of MED1, MED4, MED6, MED7, MED8, MED9, MED10, MED11, MED12, MED13, MED13L, MED14, MED15, MED16, MED17, MED18, MED19, MED20, MED21, MED22, MED23, MED24, MED25, MED26, MED27, MED29, MED30, MED31, CCNC, CDK8 and CDC2L6/CDK11. The MED12, MED13, CCNC and CDK8 subunits form a distinct module termed the CDK8 module. Mediator containing the CDK8 module is less active than Mediator lacking this module in supporting transcriptional activation. Individual preparations of the Mediator complex lacking one or more distinct subunits have been variously termed ARC, CRSP, DRIP, PC2, SMCC and TRAP (By similarity). {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP006108 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
13385626 RefSeq NP_080395 270 mediator of RNA polymerase II transcription subunit 4

Identical Sequences to LMP006108 proteins

Reference Database Accession Length Protein Name
GI:13385626 DBBJ BAB26809.1 270 unnamed protein product [Mus musculus]
GI:13385626 DBBJ BAB27118.1 270 unnamed protein product [Mus musculus]
GI:13385626 GenBank AAH24950.1 270 Mediator of RNA polymerase II transcription, subunit 4 homolog (yeast) [Mus musculus]
GI:13385626 GenBank EDL35855.1 270 mediator of RNA polymerase II transcription, subunit 4 homolog (yeast), isoform CRA_a [Mus musculus]
GI:13385626 SwissProt Q9CQA5.1 270 RecName: Full=Mediator of RNA polymerase II transcription subunit 4; AltName: Full=Mediator complex subunit 4 [Mus musculus]

Related Sequences to LMP006108 proteins

Reference Database Accession Length Protein Name
GI:13385626 DBBJ BAE26554.1 279 unnamed protein product [Mus musculus]
GI:13385626 GenBank AAH93402.1 270 Mediator complex subunit 4 [Rattus norvegicus]
GI:13385626 GenBank EDM02270.1 279 mediator of RNA polymerase II transcription, subunit 4 homolog (yeast) [Rattus norvegicus]
GI:13385626 RefSeq NP_001019427.1 270 mediator of RNA polymerase II transcription subunit 4 [Rattus norvegicus]
GI:13385626 RefSeq XP_005071027.1 270 PREDICTED: mediator of RNA polymerase II transcription subunit 4 [Mesocricetus auratus]
GI:13385626 SwissProt Q561Q8.1 270 RecName: Full=Mediator of RNA polymerase II transcription subunit 4; AltName: Full=Mediator complex subunit 4 [Rattus norvegicus]