Gene/Proteome Database (LMPD)
LMPD ID
LMP006158
Gene ID
Species
Homo sapiens (Human)
Gene Name
WD repeat domain, phosphoinositide interacting 1
Gene Symbol
Synonyms
ATG18; ATG18A; WIPI49
Alternate Names
WD repeat domain phosphoinositide-interacting protein 1; WIPI 49 kDa; WIPI-1 alpha; atg18 protein homolog; WD40 repeat protein Interacting with phosphoInositides of 49kDa; WD40 repeat protein interacting with phosphoinositides of 49 kDa
Chromosome
17
Map Location
17q24.2
Summary
WD40 repeat proteins are key components of many essential biologic functions. They regulate the assembly of multiprotein complexes by presenting a beta-propeller platform for simultaneous and reversible protein-protein interactions. Members of the WIPI subfamily of WD40 repeat proteins, such as WIPI1, have a 7-bladed propeller structure and contain a conserved motif for interaction with phospholipids (Proikas-Cezanne et al., 2004 [PubMed 15602573]).[supplied by OMIM, Mar 2008]
Orthologs
Proteins
| WD repeat domain phosphoinositide-interacting protein 1 | |
|---|---|
| Refseq ID | NP_060453 |
| Protein GI | 157388939 |
| UniProt ID | Q5MNZ9 |
| mRNA ID | NM_017983 |
| Length | 446 |
| RefSeq Status | VALIDATED |
| MEAEAADAPPGGVESALSCFSFNQDCTSLATGTKAGYKLFSLSSVEQLDQVHGSNEIPDVYIVERLFSSSLVVVVSHTKPRQMNVYHFKKGTEICNYSYSSNILSIRLNRQRLLVCLEESIYIHNIKDMKLLKTLLDIPANPTGLCALSINHSNSYLAYPGSLTSGEIVLYDGNSLKTVCTIAAHEGTLAAITFNASGSKLASASEKGTVIRVFSVPDGQKLYEFRRGMKRYVTISSLVFSMDSQFLCASSNTETVHIFKLEQVTNSRPEEPSTWSGYMGKMFMAATNYLPTQVSDMMHQDRAFATARLNFSGQRNICTLSTIQKLPRLLVASSSGHLYMYNLDPQDGGECVLIKTHSLLGSGTTEENKENDLRPSLPQSYAATVARPSASSASTVPGYSEDGGALRGEVIPEHEFATGPVCLDDENEFPPIILCRGNQKGKTKQS | |
Gene Information
Entrez Gene ID
Gene Name
WD repeat domain, phosphoinositide interacting 1
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0000139 | TAS:Reactome | C | Golgi membrane |
| GO:0000421 | IDA:UniProtKB | C | autophagic vacuole membrane |
| GO:0005737 | IDA:UniProtKB | C | cytoplasm |
| GO:0031410 | IEA:UniProtKB-KW | C | cytoplasmic vesicle |
| GO:0005856 | IEA:UniProtKB-KW | C | cytoskeleton |
| GO:0010008 | IDA:UniProtKB | C | endosome membrane |
| GO:0000407 | IDA:MGI | C | pre-autophagosomal structure |
| GO:0034045 | IDA:UniProtKB | C | pre-autophagosomal structure membrane |
| GO:0005802 | IDA:UniProtKB | C | trans-Golgi network |
| GO:0050681 | IDA:UniProtKB | F | androgen receptor binding |
| GO:0030331 | IDA:UniProtKB | F | estrogen receptor binding |
| GO:0080025 | IDA:UniProtKB | F | phosphatidylinositol-3,5-bisphosphate binding |
| GO:0032266 | IDA:UniProtKB | F | phosphatidylinositol-3-phosphate binding |
| GO:0005102 | IDA:MGI | F | receptor binding |
| GO:0006987 | TAS:Reactome | P | activation of signaling protein activity involved in unfolded protein response |
| GO:0006914 | IEP:UniProtKB | P | autophagy |
| GO:0044267 | TAS:Reactome | P | cellular protein metabolic process |
| GO:0030968 | TAS:Reactome | P | endoplasmic reticulum unfolded protein response |
| GO:0048203 | IDA:UniProtKB | P | vesicle targeting, trans-Golgi to endosome |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_18368 | IRE1alpha activates chaperones |
| REACT_17015 | Metabolism of proteins |
| REACT_18356 | Unfolded Protein Response (UPR) |
| REACT_18273 | XBP1(S) activates chaperone genes |
Domain Information
UniProt Annotations
Entry Information
Gene Name
WD repeat domain, phosphoinositide interacting 1
Protein Entry
WIPI1_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; Synonyms=WIPI-1 alpha; IsoId=Q5MNZ9-1; Sequence=Displayed; Name=2; Synonyms=WIPI-1 beta; IsoId=Q5MNZ9-2; Sequence=VSP_016966; |
| Domain | The N-terminus might form a beta-propeller domain involved in specific binding to phosphatidylinositol 3,5-bisphosphate (PIP2), leading to the association of the protein to the membrane. Association to the membrane can also occur through binding to phosphatidylinositol 3-monophosphate (PI3P). |
| Function | Plays an important role in autophagy and in particular starvation- and calcium-mediated autophagy, as well as in mitophagy. Functions upstream of the ATG12-ATG5-ATG16L1 complex and LC3, and downstream of the ULK1 and PI3-kinase complexes. Involved in xenophagy of Staphylococcus aureus. Invading S.aureus cells become entrapped in autophagosome-like WIPI1 positive vesicles targeted for lysosomal degradation. Plays also a distinct role in controlling the transcription of melanogenic enzymes and melanosome maturation, a process that is distinct from starvation- induced autophagy. May also regulate the trafficking of proteins involved in the mannose-6-phosphate receptor (MPR) recycling pathway. {ECO |
| Similarity | Belongs to the WD repeat SVP1 family. |
| Similarity | Contains 3 WD repeats. |
| Subcellular Location | Golgi apparatus, trans-Golgi network. Endosome. Cytoplasmic vesicle, clathrin-coated vesicle. Preautophagosomal structure membrane; Peripheral membrane protein. Cytoplasm, cytoskeleton. Note=Trans elements of the Golgi and peripheral endosomes. Dynamically cycles through these compartments and is susceptible to conditions that modulate membrane flux. Enriched in clathrin-coated vesicles. Upon starvation-induced autophagy, accumulates at subcellular structures in the cytoplasm: enlarged vesicular and lasso-like structures, and large cup-shaped structures predominantly around the nucleus. Recruitment to autophagic membranes is controlled by MTMR14. Labile microtubules specifically recruit markers of autophagosome formation like WIPI1, whereas mature autophagosomes may bind to stable microtubules. |
| Subunit | Interacts with androgen receptor (AR) and the estrogen receptors ESR1 and ESR2. Binds PtdIns3P and to a lesser extent, PtdIns3,5P2 and PtdIns5P in vitro. Interaction with PtdIns3P is required for recruitment to membranes. |
| Tissue Specificity | Ubiquitously expressed. Highly expressed in skeletal muscle, heart, testis, pancreas and placenta. Highly expressed in G361, Sk-mel-28, Sk-mel-13, WM852 and WM451 cells. Up-regulated in a variety of tumor tissues. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006158 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 157388939 | RefSeq | NP_060453 | 446 | WD repeat domain phosphoinositide-interacting protein 1 |
Identical Sequences to LMP006158 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:157388939 | SwissProt | Q5MNZ9.3 | 446 | RecName: Full=WD repeat domain phosphoinositide-interacting protein 1; Short=WIPI-1; AltName: Full=Atg18 protein homolog; AltName: Full=WD40 repeat protein interacting with phosphoinositides of 49 kDa; Short=WIPI 49 kDa [Homo sapiens] |
Related Sequences to LMP006158 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:157388939 | GenBank | AAH39867.1 | 446 | WD repeat domain, phosphoinositide interacting 1 [Homo sapiens] |
| GI:157388939 | GenBank | EAW89058.1 | 446 | WD repeat domain, phosphoinositide interacting 1, isoform CRA_b [Homo sapiens] |
| GI:157388939 | GenBank | EAW89059.1 | 446 | WD repeat domain, phosphoinositide interacting 1, isoform CRA_b [Homo sapiens] |
| GI:157388939 | GenBank | ADZ15640.1 | 446 | WD repeat domain, phosphoinositide interacting 1, partial [synthetic construct] |
| GI:157388939 | GenBank | AIC56621.1 | 446 | WIPI1, partial [synthetic construct] |
| GI:157388939 | RefSeq | XP_001165276.1 | 446 | PREDICTED: WD repeat domain phosphoinositide-interacting protein 1 isoform X1 [Pan troglodytes] |