Gene/Proteome Database (LMPD)
Proteins
| phytanoyl-CoA hydroxylase-interacting protein | |
|---|---|
| Refseq ID | NP_666093 |
| Protein GI | 22122427 |
| UniProt ID | Q8K0S0 |
| mRNA ID | NM_145981 |
| Length | 330 |
| RefSeq Status | PROVISIONAL |
| MELLSTPHSIEINNITCDSFRISWAMEDSDLERVTHYFIDLNKKENKNSNKFKHRDVPTKLVAKAVPLPMTVRGHWFLSPRTEYSVAVQTAVKQSDGEYLVSGWSETVEFCTGDYAKEHLAQLQEKAEQIAGRMLRFSVFYRNHHKEYFQHARTHCGNVLQPYLKDNSGSHGSPTSGMLHGVFFSCNTEFNTGQPPQDSPYGRWRFQIPAQRLFNPSTNLYFADFYCMYTAYHYAILVLAPKGSLGDRFCRDRLPLLDIACNKFLTCSVEDGELIFRHAQDLILEIIYTEPVDLSLGTLGEISGHQLMSLSTADAKKDPSCKTCNISVGR | |
Gene Information
Domain Information
UniProt Annotations
Entry Information
Gene Name
phytanoyl-CoA hydroxylase interacting protein
Protein Entry
B9EIC7_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Developmental Stage | At 18 dpc, expressed in most tissues, particularly in the skin. By neonatal day 1, the expression in brain and skin is markedly increased, whereas expression in the heart and skeletal muscles shows steady state levels similar to those observed in the fetus. At adulthood, very high expression in brain, little or no expression in other tissues. {ECO:0000269|PubMed:10686344}. |
| Function | Its interaction with PHYH suggests a role in the development of the central system. |
| Miscellaneous | Overexpression in heart induce atrial tachycardia and increased susceptibility to aconitine-induced arrhythmia, possibly due to altered expression of voltage-gated K(1+) channel and adrenergic beta1-receptor (ADRB1). |
| Sequence Caution | Sequence=AAH30494.2; Type=Erroneous initiation; Evidence={ECO:0000305}; |
| Similarity | Belongs to the PHYHIP family. {ECO:0000305}. |
| Similarity | Contains 1 fibronectin type-III domain. {ECO:0000255|PROSITE-ProRule:PRU00316}. |
| Subunit | Interacts with PHYH and BAI1. {ECO:0000269|PubMed:10686344, ECO:0000269|PubMed:11245925}. |
| Tissue Specificity | Highly expressed in the brain. {ECO:0000269|PubMed:10686344}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006200 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 22122427 | RefSeq | NP_666093 | 330 | phytanoyl-CoA hydroxylase-interacting protein |
Identical Sequences to LMP006200 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:22122427 | RefSeq | XP_006252322.1 | 330 | PREDICTED: phytanoyl-CoA hydroxylase-interacting protein [Rattus norvegicus] |
| GI:22122427 | RefSeq | XP_006252355.1 | 330 | PREDICTED: phytanoyl-CoA hydroxylase-interacting protein isoform X1 [Rattus norvegicus] |
| GI:22122427 | RefSeq | XP_006518442.1 | 330 | PREDICTED: phytanoyl-CoA hydroxylase-interacting protein isoform X1 [Mus musculus] |
| GI:22122427 | RefSeq | XP_006518443.1 | 330 | PREDICTED: phytanoyl-CoA hydroxylase-interacting protein isoform X2 [Mus musculus] |
| GI:22122427 | RefSeq | XP_006989161.1 | 330 | PREDICTED: phytanoyl-CoA hydroxylase-interacting protein [Peromyscus maniculatus bairdii] |
| GI:22122427 | RefSeq | XP_008769059.1 | 330 | PREDICTED: phytanoyl-CoA hydroxylase-interacting protein [Rattus norvegicus] |
Related Sequences to LMP006200 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:22122427 | GenBank | AAH30494.2 | 431 | Phyhip protein, partial [Mus musculus] |
| GI:22122427 | GenBank | KFO38131.1 | 330 | Phytanoyl-CoA hydroxylase-interacting protein [Fukomys damarensis] |
| GI:22122427 | RefSeq | XP_009210928.1 | 330 | PREDICTED: phytanoyl-CoA hydroxylase-interacting protein [Papio anubis] |
| GI:22122427 | RefSeq | XP_009210929.1 | 330 | PREDICTED: phytanoyl-CoA hydroxylase-interacting protein [Papio anubis] |
| GI:22122427 | RefSeq | XP_010363661.1 | 330 | PREDICTED: phytanoyl-CoA hydroxylase-interacting protein [Rhinopithecus roxellana] |
| GI:22122427 | RefSeq | XP_010363662.1 | 330 | PREDICTED: phytanoyl-CoA hydroxylase-interacting protein [Rhinopithecus roxellana] |