Gene/Proteome Database (LMPD)
Proteins
| protein arginine N-methyltransferase 5 isoform a | |
|---|---|
| Refseq ID | NP_006100 |
| Protein GI | 20070220 |
| UniProt ID | O14744 |
| mRNA ID | NM_006109 |
| Length | 637 |
| RefSeq Status | VALIDATED |
| MAAMAVGGAGGSRVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL | |
| protein arginine N-methyltransferase 5 isoform b | |
|---|---|
| Refseq ID | NP_001034708 |
| Protein GI | 88900507 |
| UniProt ID | O14744 |
| mRNA ID | NM_001039619 |
| Length | 620 |
| RefSeq Status | VALIDATED |
| MRGPNSGTEKGRLVIPEKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL | |
| protein arginine N-methyltransferase 5 isoform c | |
|---|---|
| Refseq ID | NP_001269882 |
| Protein GI | 545479147 |
| UniProt ID | O14744 |
| mRNA ID | NM_001282953 |
| Length | 576 |
| RefSeq Status | VALIDATED |
| MRGPNSGTEKGRLVIPEKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL | |
| protein arginine N-methyltransferase 5 isoform d | |
|---|---|
| Refseq ID | NP_001269883 |
| Protein GI | 545478838 |
| UniProt ID | B4DV00 |
| mRNA ID | NM_001282954 |
| Length | 531 |
| RefSeq Status | VALIDATED |
| MLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL | |
| protein arginine N-methyltransferase 5 isoform e | |
|---|---|
| Refseq ID | NP_001269884 |
| Protein GI | 545477926 |
| UniProt ID | O14744 |
| mRNA ID | NM_001282955 |
| Length | 593 |
| RefSeq Status | VALIDATED |
| MAAMAVGGAGGSRVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL | |
| protein arginine N-methyltransferase 5 isoform f | |
|---|---|
| Refseq ID | NP_001269885 |
| Protein GI | 545478755 |
| UniProt ID | O14744 |
| mRNA ID | NM_001282956 |
| Length | 466 |
| RefSeq Status | VALIDATED |
| MRGPNSGTEKGRLVIPEKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEALEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL | |
Gene Information
Entrez Gene ID
Gene Name
protein arginine methyltransferase 5
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IDA:HPA | C | cytoplasm |
| GO:0005829 | IDA:UniProtKB | C | cytosol |
| GO:0034709 | IDA:UniProtKB | C | methylosome |
| GO:0005634 | NAS:UniProtKB | C | nucleus |
| GO:0003682 | IEA:Ensembl | F | chromatin binding |
| GO:0001046 | ISS:UniProtKB | F | core promoter sequence-specific DNA binding |
| GO:0008469 | IBA:RefGenome | F | histone-arginine N-methyltransferase activity |
| GO:0008168 | IDA:MGI | F | methyltransferase activity |
| GO:0035243 | IMP:UniProtKB | F | protein-arginine omega-N symmetric methyltransferase activity |
| GO:0043021 | IPI:UniProtKB | F | ribonucleoprotein complex binding |
| GO:0003714 | ISS:UniProtKB | F | transcription corepressor activity |
| GO:0016070 | TAS:Reactome | P | RNA metabolic process |
| GO:0008283 | TAS:ProtInc | P | cell proliferation |
| GO:0032922 | ISS:UniProtKB | P | circadian regulation of gene expression |
| GO:0042118 | IMP:UniProtKB | P | endothelial cell activation |
| GO:0010467 | TAS:Reactome | P | gene expression |
| GO:0043985 | ISS:UniProtKB | P | histone H4-R3 methylation |
| GO:0034660 | TAS:Reactome | P | ncRNA metabolic process |
| GO:0000122 | IEA:Ensembl | P | negative regulation of transcription from RNA polymerase II promoter |
| GO:0035246 | IDA:MGI | P | peptidyl-arginine N-methylation |
| GO:0018216 | IMP:UniProtKB | P | peptidyl-arginine methylation |
| GO:0019918 | IMP:GOC | P | peptidyl-arginine methylation, to symmetrical-dimethyl arginine |
| GO:0007088 | TAS:ProtInc | P | regulation of mitosis |
| GO:0006355 | IBA:RefGenome | P | regulation of transcription, DNA-templated |
| GO:0000387 | IMP:UniProtKB | P | spliceosomal snRNP assembly |
| GO:0006351 | IEA:UniProtKB-KW | P | transcription, DNA-templated |
KEGG Pathway Links
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_228108 | RMTs methylate histone arginines |
| REACT_11066 | snRNP Assembly |
Domain Information
UniProt Annotations
Entry Information
Gene Name
protein arginine methyltransferase 5
Protein Entry
ANM5_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=5; Comment=Additional isoforms seems to exist. According to EST sequences.; Name=1; IsoId=O14744-1; Sequence=Displayed; Name=2; IsoId=O14744-2; Sequence=VSP_043382; Note=No experimental confirmation available.; Name=4; IsoId=O14744-4; Sequence=VSP_043382, VSP_054768; Note=No experimental confirmation available.; Name=5; IsoId=O14744-5; Sequence=VSP_054685; Note=No experimental confirmation available.; Name=3; IsoId=O14744-3; Sequence=VSP_043382, VSP_054685; Note=No experimental confirmation available.; |
| Catalytic Activity | S-adenosyl-L-methionine + arginine-[histone] = S-adenosyl-L-homocysteine + N(omega)-methyl-arginine-[histone]. |
| Enzyme Regulation | Activity is increased by EGF, HGF, FGF1 or FGF2 treatments, and slightly decreased by NGF treatment. |
| Function | Arginine methyltransferase that can both catalyze the formation of omega-N monomethylarginine (MMA) and symmetrical dimethylarginine (sDMA), with a preference for the formation of MMA. Specifically mediates the symmetrical dimethylation of arginine residues in the small nuclear ribonucleoproteins Sm D1 (SNRPD1) and Sm D3 (SNRPD3); such methylation being required for the assembly and biogenesis of snRNP core particles. Methylates SUPT5H. Mono- and dimethylates arginine residues of myelin basic protein (MBP) in vitro. Plays a role in the assembly of snRNP core particles. May play a role in cytokine-activated transduction pathways. Negatively regulates cyclin E1 promoter activity and cellular proliferation. May regulate the SUPT5H transcriptional elongation properties. May be part of a pathway that is connected to a chloride current, possibly through cytoskeletal rearrangement. Methylates histone H2A and H4 'Arg-3' during germ cell development. Methylates histone H3 'Arg-8', which may repress transcription. Methylates the Piwi proteins (PIWIL1, PIWIL2 and PIWIL4), methylation of Piwi proteins being required for the interaction with Tudor domain-containing proteins and subsequent localization to the meiotic nuage. Methylates RPS10. Attenuates EGF signaling through the MAPK1/MAPK3 pathway acting at 2 levels. First, monomethylates EGFR; this enhances EGFR 'Tyr-1197' phosphorylation and PTPN6 recruitment, eventually leading to reduced SOS1 phosphorylation. Second, methylates RAF1 and probably BRAF, hence destabilizing these 2 signaling proteins and reducing their catalytic activity. Required for induction of E-selectin and VCAM-1, on the endothelial cells surface at sites of inflammation. Methylates HOXA9. Methylates and regulates SRGAP2 which is involved in cell migration and differentiation. Acts as a transcriptional corepressor in CRY1-mediated repression of the core circadian component PER1 by regulating the H4R3 dimethylation at the PER1 promoter. {ECO |
| Interaction | Q8N8U2:CDYL2; NbExp=2; IntAct=EBI-351098, EBI-8467076; P54105:CLNS1A; NbExp=3; IntAct=EBI-351098, EBI-724693; Q9NQ92:COPRS; NbExp=6; IntAct=EBI-351098, EBI-1642558; Q01094:E2F1; NbExp=8; IntAct=EBI-351098, EBI-448924; Q8TE85:GRHL3; NbExp=2; IntAct=EBI-351098, EBI-8469396; Q9BX10:GTPBP2; NbExp=2; IntAct=EBI-351098, EBI-6115579; P62805:HIST2H4B; NbExp=3; IntAct=EBI-351098, EBI-302023; Q8WVJ2:NUDCD2; NbExp=2; IntAct=EBI-351098, EBI-1052153; Q86U06:RBM23; NbExp=3; IntAct=EBI-351098, EBI-780319; O75044:SRGAP2; NbExp=4; IntAct=EBI-351098, EBI-1051034; Q96RU7:TRIB3; NbExp=2; IntAct=EBI-351098, EBI-492476; Q9BQA1:WDR77; NbExp=6; IntAct=EBI-351098, EBI-1237307; P63104:YWHAZ; NbExp=2; IntAct=EBI-351098, EBI-347088; |
| Sequence Caution | Sequence=BC005820; Type=Frameshift; Positions=370; Evidence= ; |
| Similarity | Belongs to the class I-like SAM-binding methyltransferase superfamily. Protein arginine N- methyltransferase family. |
| Similarity | Contains 1 SAM-dependent MTase PRMT-type domain. |
| Subcellular Location | Cytoplasm. Nucleus. |
| Subunit | Forms, at least, homodimers and homotetramers. Interacts with PRDM1 (By similarity). Component of the methylosome, a 20S complex containing at least CLNS1A/pICln, PRMT5/SKB1 and WDR77/MEP50. Interacts with EGFR; methylates EGFR and stimulates EGFR-mediated ERK activation. Interacts with HOXA9. Interacts with SRGAP2. Found in a complex with COPRS, RUNX1 AND CBFB. Interacts with CHTOP; the interaction symmetrically methylates CHTOP, but seems to require the presence of PRMT1 (By similarity). Interacts with EPB41L3; this modulates methylation of target proteins. Component of a high molecular weight E2F-pocket protein complex, CERC (cyclin E1 repressor complex). Associates with SWI/SNF remodeling complexes containing SMARCA2 and SMARCA4. Interacts with JAK2, SSTR1, SUPT5H, BRAF and with active RAF1. Interacts with LSM11, PRMT7 and SNRPD3. Interacts with COPRS; promoting its recruitment on histone H4. Interacts with CLNS1A/pICln. Identified in a complex with CLNS1A/pICln and Sm proteins. Interacts with RPS10. Interacts with WDR77. Interacts with IWS1. Interacts with CRY1. {ECO |
| Tissue Specificity | Ubiquitous. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006274 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 20070220 | RefSeq | NP_006100 | 637 | protein arginine N-methyltransferase 5 isoform a |
| 88900507 | RefSeq | NP_001034708 | 620 | protein arginine N-methyltransferase 5 isoform b |
| 545479147 | RefSeq | NP_001269882 | 576 | protein arginine N-methyltransferase 5 isoform c |
| 545478838 | RefSeq | NP_001269883 | 531 | protein arginine N-methyltransferase 5 isoform d |
| 545477926 | RefSeq | NP_001269884 | 593 | protein arginine N-methyltransferase 5 isoform e |
| 545478755 | RefSeq | NP_001269885 | 466 | protein arginine N-methyltransferase 5 isoform f |
Identical Sequences to LMP006274 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:545479147 | DBBJ | BAG63261.1 | 576 | unnamed protein product [Homo sapiens] |
| GI:545478755 | GenBank | EAW66220.1 | 466 | protein arginine methyltransferase 5, isoform CRA_c [Homo sapiens] |
| GI:88900507 | GenBank | JAA07291.1 | 620 | protein arginine methyltransferase 5 [Pan troglodytes] |
| GI:20070220 | GenBank | JAA13058.1 | 637 | protein arginine methyltransferase 5 [Pan troglodytes] |
| GI:20070220 | GenBank | JAA27673.1 | 637 | protein arginine methyltransferase 5 [Pan troglodytes] |
| GI:88900507 | GenBank | JAA27674.1 | 620 | protein arginine methyltransferase 5 [Pan troglodytes] |
| GI:88900507 | RefSeq | XP_003260649.1 | 620 | PREDICTED: protein arginine N-methyltransferase 5 isoform 2 [Nomascus leucogenys] |
| GI:545477926 | RefSeq | XP_003260650.1 | 593 | PREDICTED: protein arginine N-methyltransferase 5 isoform 3 [Nomascus leucogenys] |
| GI:545479147 | RefSeq | XP_003260652.1 | 576 | PREDICTED: protein arginine N-methyltransferase 5 isoform 5 [Nomascus leucogenys] |
| GI:88900507 | RefSeq | XP_003808153.1 | 620 | PREDICTED: protein arginine N-methyltransferase 5 isoform X2 [Pan paniscus] |
| GI:545477926 | RefSeq | XP_003808154.1 | 593 | PREDICTED: protein arginine N-methyltransferase 5 isoform X3 [Pan paniscus] |
| GI:545479147 | RefSeq | XP_003808156.1 | 576 | PREDICTED: protein arginine N-methyltransferase 5 isoform X4 [Pan paniscus] |
| GI:20070220 | RefSeq | XP_004054963.1 | 637 | PREDICTED: protein arginine N-methyltransferase 5 isoform 1 [Gorilla gorilla gorilla] |
| GI:545477926 | RefSeq | XP_004054965.1 | 593 | PREDICTED: protein arginine N-methyltransferase 5 isoform 3 [Gorilla gorilla gorilla] |
| GI:545478838 | RefSeq | XP_004054966.1 | 531 | PREDICTED: protein arginine N-methyltransferase 5 isoform 4 [Gorilla gorilla gorilla] |
| GI:545478838 | RefSeq | XP_005560878.1 | 531 | PREDICTED: protein arginine N-methyltransferase 5 isoform X3 [Macaca fascicularis] |
| GI:20070220 | RefSeq | XP_008063454.1 | 637 | PREDICTED: protein arginine N-methyltransferase 5 isoform X1 [Tarsius syrichta] |
| GI:88900507 | RefSeq | XP_008063455.1 | 620 | PREDICTED: protein arginine N-methyltransferase 5 isoform X2 [Tarsius syrichta] |
| GI:545478838 | RefSeq | XP_008063457.1 | 531 | PREDICTED: protein arginine N-methyltransferase 5 isoform X4 [Tarsius syrichta] |
| GI:545478838 | RefSeq | XP_008063458.1 | 531 | PREDICTED: protein arginine N-methyltransferase 5 isoform X4 [Tarsius syrichta] |
| GI:545478838 | RefSeq | XP_009209411.1 | 531 | PREDICTED: protein arginine N-methyltransferase 5 isoform X3 [Papio anubis] |
| GI:20070220 | RefSeq | XP_009425725.1 | 637 | PREDICTED: protein arginine N-methyltransferase 5 isoform X1 [Pan troglodytes] |
| GI:88900507 | RefSeq | XP_009425726.1 | 620 | PREDICTED: protein arginine N-methyltransferase 5 isoform X2 [Pan troglodytes] |
| GI:545478838 | RefSeq | XP_009425727.1 | 531 | PREDICTED: protein arginine N-methyltransferase 5 isoform X3 [Pan troglodytes] |
| GI:20070220 | RefSeq | XP_010376666.1 | 637 | PREDICTED: protein arginine N-methyltransferase 5 isoform X1 [Rhinopithecus roxellana] |
Related Sequences to LMP006274 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:545478838 | DBBJ | BAG70060.1 | 637 | protein arginine methyltransferase 5 isoform a [Homo sapiens] |
| GI:545478838 | DBBJ | BAG70184.1 | 637 | protein arginine methyltransferase 5 isoform a, partial [Homo sapiens] |
| GI:20070220 | EMBL | CAH92718.1 | 637 | hypothetical protein [Pongo abelii] |
| GI:20070220 | GenBank | AAV38169.1 | 638 | SKB1 homolog (S. pombe), partial [synthetic construct] |
| GI:545478838 | GenBank | EAW66218.1 | 637 | protein arginine methyltransferase 5, isoform CRA_b [Homo sapiens] |
| GI:545478838 | GenBank | EAW66219.1 | 637 | protein arginine methyltransferase 5, isoform CRA_b [Homo sapiens] |
| GI:88900507 | GenBank | AFH30778.1 | 620 | protein arginine N-methyltransferase 5 isoform b [Macaca mulatta] |
| GI:88900507 | GenBank | AFI35973.1 | 620 | protein arginine N-methyltransferase 5 isoform b [Macaca mulatta] |
| GI:20070220 | RefSeq | NP_001126589.1 | 637 | protein arginine N-methyltransferase 5 [Pongo abelii] |
| GI:545478838 | RefSeq | XP_003260648.1 | 637 | PREDICTED: protein arginine N-methyltransferase 5 isoform 1 [Nomascus leucogenys] |
| GI:88900507 | RefSeq | NP_001244996.1 | 620 | protein arginine N-methyltransferase 5 [Macaca mulatta] |
| GI:545479147 | RefSeq | XP_003801962.1 | 576 | PREDICTED: protein arginine N-methyltransferase 5 isoform 5 [Otolemur garnettii] |
| GI:88900507 | RefSeq | XP_003901616.1 | 620 | PREDICTED: protein arginine N-methyltransferase 5 isoform X2 [Papio anubis] |
| GI:545479147 | RefSeq | XP_004010393.1 | 576 | PREDICTED: protein arginine N-methyltransferase 5 isoform 4 [Ovis aries] |
| GI:88900507 | RefSeq | XP_004054964.1 | 620 | PREDICTED: protein arginine N-methyltransferase 5 isoform 2 [Gorilla gorilla gorilla] |
| GI:545479147 | RefSeq | XP_004054967.1 | 576 | PREDICTED: protein arginine N-methyltransferase 5 isoform 5 [Gorilla gorilla gorilla] |
| GI:545479147 | RefSeq | XP_004283236.1 | 576 | PREDICTED: protein arginine N-methyltransferase 5 isoform 3 [Orcinus orca] |
| GI:545479147 | RefSeq | XP_004313408.1 | 576 | PREDICTED: protein arginine N-methyltransferase 5 isoform 3 [Tursiops truncatus] |
| GI:545477926 | RefSeq | XP_004402161.1 | 593 | PREDICTED: protein arginine N-methyltransferase 5 isoform 3 [Odobenus rosmarus divergens] |
| GI:545477926 | RefSeq | XP_004421301.1 | 593 | PREDICTED: protein arginine N-methyltransferase 5 isoform 2 [Ceratotherium simum simum] |
| GI:20070220 | RefSeq | XP_005560876.1 | 644 | PREDICTED: protein arginine N-methyltransferase 5 isoform X1 [Macaca fascicularis] |
| GI:88900507 | RefSeq | XP_005560877.1 | 620 | PREDICTED: protein arginine N-methyltransferase 5 isoform X2 [Macaca fascicularis] |
| GI:545477926 | RefSeq | XP_005882317.1 | 593 | PREDICTED: protein arginine N-methyltransferase 5 isoform X3 [Myotis brandtii] |
| GI:545478755 | RefSeq | XP_005882319.1 | 466 | PREDICTED: protein arginine N-methyltransferase 5 isoform X5 [Myotis brandtii] |
| GI:545479147 | RefSeq | XP_005895511.1 | 576 | PREDICTED: protein arginine N-methyltransferase 5 isoform X4 [Bos mutus] |
| GI:545478755 | RefSeq | XP_005895513.1 | 466 | PREDICTED: protein arginine N-methyltransferase 5 isoform X6 [Bos mutus] |
| GI:545477926 | RefSeq | XP_005978051.1 | 593 | PREDICTED: protein arginine N-methyltransferase 5 isoform X3 [Pantholops hodgsonii] |
| GI:545478755 | RefSeq | XP_005978054.1 | 466 | PREDICTED: protein arginine N-methyltransferase 5 isoform X6 [Pantholops hodgsonii] |
| GI:545478755 | RefSeq | XP_006100140.1 | 466 | PREDICTED: protein arginine N-methyltransferase 5 isoform X5 [Myotis lucifugus] |
| GI:545478755 | RefSeq | XP_006066564.1 | 466 | PREDICTED: protein arginine N-methyltransferase 5 isoform X6 [Bubalus bubalis] |
| GI:545477926 | RefSeq | XP_007449592.1 | 593 | PREDICTED: protein arginine N-methyltransferase 5 isoform X3 [Lipotes vexillifer] |
| GI:545478755 | RefSeq | XP_007449595.1 | 466 | PREDICTED: protein arginine N-methyltransferase 5 isoform X6 [Lipotes vexillifer] |
| GI:545477926 | RefSeq | XP_007949368.1 | 593 | PREDICTED: protein arginine N-methyltransferase 5 isoform X3 [Orycteropus afer afer] |
| GI:20070220 | RefSeq | XP_007988979.1 | 637 | PREDICTED: protein arginine N-methyltransferase 5 isoform X1 [Chlorocebus sabaeus] |
| GI:545478838 | RefSeq | XP_008063454.1 | 637 | PREDICTED: protein arginine N-methyltransferase 5 isoform X1 [Tarsius syrichta] |
| GI:20070220 | SwissProt | Q5R698.3 | 637 | RecName: Full=Protein arginine N-methyltransferase 5; AltName: Full=Histone-arginine N-methyltransferase PRMT5; AltName: Full=Shk1 kinase-binding protein 1 homolog; Short=SKB1 homolog [Pongo abelii] |