Gene/Proteome Database (LMPD)
LMPD ID
LMP006281
Gene ID
Species
Homo sapiens (Human)
Gene Name
zinc finger, DHHC-type containing 15
Gene Symbol
Synonyms
MRX91
Chromosome
X
Map Location
Xq13.3
EC Number
2.3.1.225
Summary
The protein encoded by this gene belongs to the DHHC palmitoyltransferase family. Mutations in this gene are associated with mental retardatio X-linked type 91 (MRX91). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009]
Orthologs
Proteins
palmitoyltransferase ZDHHC15 isoform 1 | |
---|---|
Refseq ID | NP_659406 |
Protein GI | 21450653 |
UniProt ID | Q96MV8 |
mRNA ID | NM_144969 |
Length | 337 |
RefSeq Status | REVIEWED |
MRRGWKMALSGGLRCCRRVLSWVPVLVIVLVVLWSYYAYVFELCLVTVLSPAEKVIYLILYHAIFVFFTWTYWKSIFTLPQQPNQKFHLSYTDKERYENEERPEVQKQMLVDMAKKLPVYTRTGSGAVRFCDRCHLIKPDRCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQFLAYSVLYCLYIATTVFSYFIKYWRGELPSVRSKFHVLFLLFVACMFFVSLVILFGYHCWLVSRNKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDKKKFWLIPIGSSPGDGHSFPMRSMNESQNPLLANEETWEDNEDDNQDYPEGSSSLAVETET |
palmitoyltransferase ZDHHC15 isoform 2 | |
---|---|
Refseq ID | NP_001139728 |
Protein GI | 226342941 |
UniProt ID | Q96MV8 |
mRNA ID | NM_001146256 |
Length | 328 |
RefSeq Status | REVIEWED |
MRRGWKMALSGGLRCCRRVLSWVPVLVIVLVVLWSYYAYVFELCLVIYLILYHAIFVFFTWTYWKSIFTLPQQPNQKFHLSYTDKERYENEERPEVQKQMLVDMAKKLPVYTRTGSGAVRFCDRCHLIKPDRCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQFLAYSVLYCLYIATTVFSYFIKYWRGELPSVRSKFHVLFLLFVACMFFVSLVILFGYHCWLVSRNKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDKKKFWLIPIGSSPGDGHSFPMRSMNESQNPLLANEETWEDNEDDNQDYPEGSSSLAVETET |
palmitoyltransferase ZDHHC15 isoform 3 | |
---|---|
Refseq ID | NP_001139729 |
Protein GI | 226342943 |
UniProt ID | Q96MV8 |
mRNA ID | NM_001146257 |
Length | 143 |
RefSeq Status | REVIEWED |
MRRGWKMALSGGLRCCRRVLSWVPVLVIVLVVLWSYYAYVFELCLVIYLILYHAIFVFFTWTYWKSIFTLPQQPNQKFHLSYTDKERYENEERPEVQKQMLVDMAKKLPVYTRTGSGGQFIQRQLERQLSKYLRKAKSYMFSN |
Gene Information
Entrez Gene ID
Gene Name
zinc finger, DHHC-type containing 15
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0070062 | IDA:UniProt | C | extracellular vesicular exosome |
GO:0005794 | IDA:UniProt | C | Golgi apparatus |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0016409 | IDA:UniProt | F | palmitoyltransferase activity |
GO:0019706 | IEA:UniProtKB-EC | F | protein-cysteine S-palmitoyltransferase activity |
GO:0008270 | IEA:InterPro | F | zinc ion binding |
GO:0045184 | IEA:Ensembl | P | establishment of protein localization |
GO:0018345 | IDA:UniProt | P | protein palmitoylation |
GO:0016188 | IEA:Ensembl | P | synaptic vesicle maturation |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR001594 | Zinc finger, DHHC-type, palmitoyltransferase |
UniProt Annotations
Entry Information
Gene Name
zinc finger, DHHC-type containing 15
Protein Entry
ZDH15_HUMAN
UniProt ID
Species
Human
Comments
Comment Type | Description |
---|---|
Alternative Products | Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q96MV8-1; Sequence=Displayed; Name=2; IsoId=Q96MV8-2; Sequence=VSP_013206, VSP_013207, VSP_013208; Note=No experimental confirmation available.; Name=3; IsoId=Q96MV8-3; Sequence=VSP_013206; Note=No experimental confirmation available.; |
Catalytic Activity | Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA. |
Disease | Mental retardation, X-linked 91 (MRX91) [MIM |
Domain | The DHHC domain is required for palmitoyltransferase activity. |
Function | Palmitoyltransferase specific for GAP43 and DLG4/PSD95. |
Ptm | Autopalmitoylated. |
Similarity | Belongs to the DHHC palmitoyltransferase family. |
Similarity | Contains 1 DHHC-type zinc finger. |
Subcellular Location | Membrane ; Multi-pass membrane protein . |
Tissue Specificity | Expressed in placenta, liver, lung, kidney, heart and brain. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006281 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
21450653 | RefSeq | NP_659406 | 337 | palmitoyltransferase ZDHHC15 isoform 1 |
226342941 | RefSeq | NP_001139728 | 328 | palmitoyltransferase ZDHHC15 isoform 2 |
226342943 | RefSeq | NP_001139729 | 143 | palmitoyltransferase ZDHHC15 isoform 3 |
Identical Sequences to LMP006281 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:226342941 | DBBJ | BAG53779.1 | 328 | unnamed protein product [Homo sapiens] |
GI:21450653 | DBBJ | BAI46173.1 | 337 | zinc finger, DHHC-type containing protein 15, partial [synthetic construct] |
GI:21450653 | GenBank | ABE14981.1 | 337 | Sequence 2514 from patent US 6979557 |
GI:21450653 | GenBank | EAW98628.1 | 337 | zinc finger, DHHC-type containing 15, isoform CRA_b [Homo sapiens] |
GI:226342943 | GenBank | ADL91503.1 | 143 | Sequence 510 from patent US 7709602 |
GI:226342943 | GenBank | ADL91813.1 | 143 | Sequence 510 from patent US 7709603 |
GI:226342943 | GenBank | ADL97894.1 | 143 | Sequence 510 from patent US 7718770 |
GI:226342943 | GenBank | AEU55341.1 | 143 | Sequence 510 from patent US 8063186 |
GI:21450653 | GenBank | AGJ46266.1 | 337 | Sequence 34 from patent US 8404655 |
GI:21450653 | GenBank | AIC53285.1 | 337 | ZDHHC15, partial [synthetic construct] |
GI:226342943 | RefSeq | XP_004064464.1 | 143 | PREDICTED: palmitoyltransferase ZDHHC15-like isoform 1 [Gorilla gorilla gorilla] |
GI:21450653 | RefSeq | XP_006724687.1 | 337 | PREDICTED: palmitoyltransferase ZDHHC15 isoform X1 [Homo sapiens] |
GI:226342943 | RefSeq | XP_008976362.1 | 143 | PREDICTED: palmitoyltransferase ZDHHC15 isoform X3 [Pan paniscus] |
Related Sequences to LMP006281 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:226342941 | DBBJ | BAG54696.1 | 328 | unnamed protein product [Homo sapiens] |
GI:226342943 | GenBank | EAW98629.1 | 309 | zinc finger, DHHC-type containing 15, isoform CRA_c [Homo sapiens] |
GI:21450653 | GenBank | EHH30859.1 | 337 | Palmitoyltransferase ZDHHC15 [Macaca mulatta] |
GI:21450653 | GenBank | EHH61007.1 | 337 | Palmitoyltransferase ZDHHC15 [Macaca fascicularis] |
GI:21450653 | GenBank | JAA37490.1 | 337 | zinc finger, DHHC-type containing 15 [Pan troglodytes] |
GI:226342943 | GenBank | JAA37491.1 | 152 | zinc finger, DHHC-type containing 15 [Pan troglodytes] |
GI:226342941 | GenBank | JAA37492.1 | 328 | zinc finger, DHHC-type containing 15 [Pan troglodytes] |
GI:21450653 | RefSeq | XP_002831868.1 | 337 | PREDICTED: palmitoyltransferase ZDHHC15 isoform X1 [Pongo abelii] |
GI:21450653 | RefSeq | XP_003269032.1 | 337 | PREDICTED: palmitoyltransferase ZDHHC15 isoform 1 [Nomascus leucogenys] |
GI:226342941 | RefSeq | XP_003269033.1 | 328 | PREDICTED: palmitoyltransferase ZDHHC15 isoform 2 [Nomascus leucogenys] |
GI:226342941 | RefSeq | XP_003779714.1 | 328 | PREDICTED: palmitoyltransferase ZDHHC15 isoform X2 [Pongo abelii] |
GI:21450653 | RefSeq | XP_003824445.1 | 337 | PREDICTED: palmitoyltransferase ZDHHC15 isoform X1 [Pan paniscus] |
GI:226342941 | RefSeq | XP_003824446.1 | 328 | PREDICTED: palmitoyltransferase ZDHHC15 isoform X2 [Pan paniscus] |
GI:226342943 | RefSeq | XP_004283864.1 | 138 | PREDICTED: palmitoyltransferase ZDHHC15 [Orcinus orca] |
GI:226342941 | RefSeq | XP_005594042.1 | 328 | PREDICTED: palmitoyltransferase ZDHHC15 isoform X2 [Macaca fascicularis] |
GI:226342943 | RefSeq | XP_005954291.1 | 138 | PREDICTED: palmitoyltransferase ZDHHC15 isoform X2 [Pantholops hodgsonii] |
GI:226342943 | RefSeq | XP_007448633.1 | 138 | PREDICTED: palmitoyltransferase ZDHHC15 [Lipotes vexillifer] |
GI:226342943 | RefSeq | XP_009437553.1 | 137 | PREDICTED: palmitoyltransferase ZDHHC15-like [Pan troglodytes] |