Gene/Proteome Database (LMPD)

LMPD ID
LMP006281
Gene ID
Species
Homo sapiens (Human)
Gene Name
zinc finger, DHHC-type containing 15
Gene Symbol
Synonyms
MRX91
Chromosome
X
Map Location
Xq13.3
EC Number
2.3.1.225
Summary
The protein encoded by this gene belongs to the DHHC palmitoyltransferase family. Mutations in this gene are associated with mental retardatio X-linked type 91 (MRX91). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009]
Orthologs

Proteins

palmitoyltransferase ZDHHC15 isoform 1
Refseq ID NP_659406
Protein GI 21450653
UniProt ID Q96MV8
mRNA ID NM_144969
Length 337
RefSeq Status REVIEWED
MRRGWKMALSGGLRCCRRVLSWVPVLVIVLVVLWSYYAYVFELCLVTVLSPAEKVIYLILYHAIFVFFTWTYWKSIFTLPQQPNQKFHLSYTDKERYENEERPEVQKQMLVDMAKKLPVYTRTGSGAVRFCDRCHLIKPDRCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQFLAYSVLYCLYIATTVFSYFIKYWRGELPSVRSKFHVLFLLFVACMFFVSLVILFGYHCWLVSRNKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDKKKFWLIPIGSSPGDGHSFPMRSMNESQNPLLANEETWEDNEDDNQDYPEGSSSLAVETET
palmitoyltransferase ZDHHC15 isoform 2
Refseq ID NP_001139728
Protein GI 226342941
UniProt ID Q96MV8
mRNA ID NM_001146256
Length 328
RefSeq Status REVIEWED
MRRGWKMALSGGLRCCRRVLSWVPVLVIVLVVLWSYYAYVFELCLVIYLILYHAIFVFFTWTYWKSIFTLPQQPNQKFHLSYTDKERYENEERPEVQKQMLVDMAKKLPVYTRTGSGAVRFCDRCHLIKPDRCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQFLAYSVLYCLYIATTVFSYFIKYWRGELPSVRSKFHVLFLLFVACMFFVSLVILFGYHCWLVSRNKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDKKKFWLIPIGSSPGDGHSFPMRSMNESQNPLLANEETWEDNEDDNQDYPEGSSSLAVETET
palmitoyltransferase ZDHHC15 isoform 3
Refseq ID NP_001139729
Protein GI 226342943
UniProt ID Q96MV8
mRNA ID NM_001146257
Length 143
RefSeq Status REVIEWED
MRRGWKMALSGGLRCCRRVLSWVPVLVIVLVVLWSYYAYVFELCLVIYLILYHAIFVFFTWTYWKSIFTLPQQPNQKFHLSYTDKERYENEERPEVQKQMLVDMAKKLPVYTRTGSGGQFIQRQLERQLSKYLRKAKSYMFSN

Gene Information

Entrez Gene ID
Gene Name
zinc finger, DHHC-type containing 15
Gene Symbol
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005794 IDA:UniProt C Golgi apparatus
GO:0070062 IDA:UniProt C extracellular vesicular exosome
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0016409 IDA:UniProt F palmitoyltransferase activity
GO:0019706 IEA:UniProtKB-EC F protein-cysteine S-palmitoyltransferase activity
GO:0008270 IEA:InterPro F zinc ion binding
GO:0045184 IEA:Ensembl P establishment of protein localization
GO:0018345 IDA:UniProt P protein palmitoylation
GO:0016188 IEA:Ensembl P synaptic vesicle maturation

Domain Information

InterPro Annotations

Accession Description
IPR001594 Zinc finger, DHHC-type, palmitoyltransferase

UniProt Annotations

Entry Information

Gene Name
zinc finger, DHHC-type containing 15
Protein Entry
ZDH15_HUMAN
UniProt ID
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q96MV8-1; Sequence=Displayed; Name=2; IsoId=Q96MV8-2; Sequence=VSP_013206, VSP_013207, VSP_013208; Note=No experimental confirmation available.; Name=3; IsoId=Q96MV8-3; Sequence=VSP_013206; Note=No experimental confirmation available.;
Catalytic Activity Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA.
Disease Mental retardation, X-linked 91 (MRX91) [MIM
Domain The DHHC domain is required for palmitoyltransferase activity.
Function Palmitoyltransferase specific for GAP43 and DLG4/PSD95.
Ptm Autopalmitoylated.
Similarity Belongs to the DHHC palmitoyltransferase family.
Similarity Contains 1 DHHC-type zinc finger.
Subcellular Location Membrane ; Multi-pass membrane protein .
Tissue Specificity Expressed in placenta, liver, lung, kidney, heart and brain.

Identical and Related Proteins

Unique RefSeq proteins for LMP006281 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
21450653 RefSeq NP_659406 337 palmitoyltransferase ZDHHC15 isoform 1
226342941 RefSeq NP_001139728 328 palmitoyltransferase ZDHHC15 isoform 2
226342943 RefSeq NP_001139729 143 palmitoyltransferase ZDHHC15 isoform 3

Identical Sequences to LMP006281 proteins

Reference Database Accession Length Protein Name
GI:226342941 DBBJ BAG53779.1 328 unnamed protein product [Homo sapiens]
GI:21450653 DBBJ BAI46173.1 337 zinc finger, DHHC-type containing protein 15, partial [synthetic construct]
GI:21450653 GenBank ABE14981.1 337 Sequence 2514 from patent US 6979557
GI:21450653 GenBank EAW98628.1 337 zinc finger, DHHC-type containing 15, isoform CRA_b [Homo sapiens]
GI:226342943 GenBank ADL91503.1 143 Sequence 510 from patent US 7709602
GI:226342943 GenBank ADL91813.1 143 Sequence 510 from patent US 7709603
GI:226342943 GenBank ADL97894.1 143 Sequence 510 from patent US 7718770
GI:226342943 GenBank AEU55341.1 143 Sequence 510 from patent US 8063186
GI:21450653 GenBank AGJ46266.1 337 Sequence 34 from patent US 8404655
GI:21450653 GenBank AIC53285.1 337 ZDHHC15, partial [synthetic construct]
GI:226342943 RefSeq XP_004064464.1 143 PREDICTED: palmitoyltransferase ZDHHC15-like isoform 1 [Gorilla gorilla gorilla]
GI:21450653 RefSeq XP_006724687.1 337 PREDICTED: palmitoyltransferase ZDHHC15 isoform X1 [Homo sapiens]
GI:226342943 RefSeq XP_008976362.1 143 PREDICTED: palmitoyltransferase ZDHHC15 isoform X3 [Pan paniscus]

Related Sequences to LMP006281 proteins

Reference Database Accession Length Protein Name
GI:226342941 DBBJ BAG54696.1 328 unnamed protein product [Homo sapiens]
GI:226342943 GenBank EAW98629.1 309 zinc finger, DHHC-type containing 15, isoform CRA_c [Homo sapiens]
GI:21450653 GenBank EHH30859.1 337 Palmitoyltransferase ZDHHC15 [Macaca mulatta]
GI:21450653 GenBank EHH61007.1 337 Palmitoyltransferase ZDHHC15 [Macaca fascicularis]
GI:21450653 GenBank JAA37490.1 337 zinc finger, DHHC-type containing 15 [Pan troglodytes]
GI:226342943 GenBank JAA37491.1 152 zinc finger, DHHC-type containing 15 [Pan troglodytes]
GI:226342941 GenBank JAA37492.1 328 zinc finger, DHHC-type containing 15 [Pan troglodytes]
GI:21450653 RefSeq XP_002831868.1 337 PREDICTED: palmitoyltransferase ZDHHC15 isoform X1 [Pongo abelii]
GI:21450653 RefSeq XP_003269032.1 337 PREDICTED: palmitoyltransferase ZDHHC15 isoform 1 [Nomascus leucogenys]
GI:226342941 RefSeq XP_003269033.1 328 PREDICTED: palmitoyltransferase ZDHHC15 isoform 2 [Nomascus leucogenys]
GI:226342941 RefSeq XP_003779714.1 328 PREDICTED: palmitoyltransferase ZDHHC15 isoform X2 [Pongo abelii]
GI:21450653 RefSeq XP_003824445.1 337 PREDICTED: palmitoyltransferase ZDHHC15 isoform X1 [Pan paniscus]
GI:226342941 RefSeq XP_003824446.1 328 PREDICTED: palmitoyltransferase ZDHHC15 isoform X2 [Pan paniscus]
GI:226342943 RefSeq XP_004283864.1 138 PREDICTED: palmitoyltransferase ZDHHC15 [Orcinus orca]
GI:226342941 RefSeq XP_005594042.1 328 PREDICTED: palmitoyltransferase ZDHHC15 isoform X2 [Macaca fascicularis]
GI:226342943 RefSeq XP_005954291.1 138 PREDICTED: palmitoyltransferase ZDHHC15 isoform X2 [Pantholops hodgsonii]
GI:226342943 RefSeq XP_007448633.1 138 PREDICTED: palmitoyltransferase ZDHHC15 [Lipotes vexillifer]
GI:226342943 RefSeq XP_009437553.1 137 PREDICTED: palmitoyltransferase ZDHHC15-like [Pan troglodytes]