Gene/Proteome Database (LMPD)
LMPD ID
LMP006430
Gene ID
Species
Homo sapiens (Human)
Gene Name
protein tyrosine phosphatase, mitochondrial 1
Gene Symbol
Synonyms
DUSP23; MOSP; PLIP
Alternate Names
phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1; PTEN-like phosphatase; phosphoinositide lipid phosphatase; protein-tyrosine phosphatase mitochondrial 1; NB4 apoptosis/differentiation related protein
Chromosome
11
Map Location
11p11.2
EC Number
3.1.3.27
Proteins
phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 isoform 1 | |
---|---|
Refseq ID | NP_783859 |
Protein GI | 148224884 |
UniProt ID | Q8WUK0 |
mRNA ID | NM_175732 |
Length | 201 |
RefSeq Status | VALIDATED |
MAATALLEAGLARVLFYPTLLYTLFRGKVPGRAHRDWYHRIDPTVLLGALPLRSLTRQLVQDENVRGVITMNEEYETRFLCNSSQEWKRLGVEQLRLSTVDMTGIPTLDNLQKGVQFALKYQSLGQCVYVHCKAGRSRSATMVAAYLIQVHKWSPEEAVRAIAKIRSYIHIRPGQLDVLKEFHKQITARATKDGTFVISKT | |
transit_peptide: 1..27 inference: non-experimental evidence, no additional details recorded note: Mitochondrion (Potential); propagated from UniProtKB/Swiss-Prot (Q8WUK0.1) calculated_mol_wt: 2973 peptide sequence: MAATALLEAGLARVLFYPTLLYTLFRG transit_peptide: 1..27 inference: non-experimental evidence, no additional details recorded note: Mitochondrion (Potential); propagated from UniProtKB/Swiss-Prot (Q8WUK0.1) calculated_mol_wt: 2973 peptide sequence: MAATALLEAGLARVLFYPTLLYTLFRG mat_peptide: 28..201 product: Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q8WUK0.1) calculated_mol_wt: 19889 peptide sequence: KVPGRAHRDWYHRIDPTVLLGALPLRSLTRQLVQDENVRGVITMNEEYETRFLCNSSQEWKRLGVEQLRLSTVDMTGIPTLDNLQKGVQFALKYQSLGQCVYVHCKAGRSRSATMVAAYLIQVHKWSPEEAVRAIAKIRSYIHIRPGQLDVLKEFHKQITARATKDGTFVISKT |
phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 isoform 2 | |
---|---|
Refseq ID | NP_001137456 |
Protein GI | 221218988 |
UniProt ID | Q8WUK0 |
mRNA ID | NM_001143984 |
Length | 151 |
RefSeq Status | VALIDATED |
MAATALLEAGLARVLFYPTLLYTLFRGKVPGRAHRDWYHRIDPTVLLGALPLRSLTRQVSRAGEPGPLPRPRRSVPVGPLGSPPSLLSHLFASAAGTGRERARGDHHERGVRDEVPVQLFTGAQMESRGGCKSHRQDPVIHPHQAWPAGCS |
Gene Information
Entrez Gene ID
Gene Name
protein tyrosine phosphatase, mitochondrial 1
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005743 | IEA:UniProtKB-KW | C | mitochondrial inner membrane |
GO:0005739 | IBA:RefGenome | C | mitochondrion |
GO:0005634 | IDA:UniProt | C | nucleus |
GO:0008962 | ISS:UniProtKB | F | phosphatidylglycerophosphatase activity |
GO:0004439 | IBA:RefGenome | F | phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity |
GO:0004725 | IEA:UniProtKB-EC | F | protein tyrosine phosphatase activity |
GO:0008138 | IBA:RefGenome | F | protein tyrosine/serine/threonine phosphatase activity |
GO:0032049 | ISS:UniProtKB | P | cardiolipin biosynthetic process |
GO:0046474 | TAS:Reactome | P | glycerophospholipid biosynthetic process |
GO:0046855 | IBA:RefGenome | P | inositol phosphate dephosphorylation |
GO:0006655 | TAS:Reactome | P | phosphatidylglycerol biosynthetic process |
GO:0006644 | TAS:Reactome | P | phospholipid metabolic process |
GO:0006470 | IBA:RefGenome | P | protein dephosphorylation |
GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
BIOCYC Pathway Links
BIOCYC Pathway ID | Description |
---|---|
PWY-6368 | 3-phosphoinositide degradation |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
REACT_121401 | Glycerophospholipid biosynthesis |
REACT_120870 | Phospholipid metabolism |
REACT_121280 | Synthesis of PG |
Domain Information
UniProt Annotations
Entry Information
Gene Name
protein tyrosine phosphatase, mitochondrial 1
Protein Entry
PTPM1_HUMAN
UniProt ID
Species
Human
Comments
Comment Type | Description |
---|---|
Alternative Products | Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q8WUK0-1; Sequence=Displayed; Name=2; IsoId=Q8WUK0-2; Sequence=VSP_015009; Name=3; IsoId=Q8WUK0-3; Sequence=VSP_045030, VSP_045031; Note=No experimental confirmation available.; |
Catalytic Activity | [a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate. |
Catalytic Activity | Phosphatidylglycerophosphate + H(2)O = phosphatidylglycerol + phosphate. |
Catalytic Activity | Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate. |
Caution | Was originally erroneously termed DUSP23. |
Function | Lipid phosphatase which dephosphorylates phosphatidylglycerophosphate (PGP) to phosphatidylglycerol (PG). PGP is an essential intermediate in the biosynthetic pathway of cardiolipin, a mitochondrial-specific phospholipid regulating the membrane integrity and activities of the organelle. Has also been shown to display phosphatase activity toward phosphoprotein substrates, specifically mediates dephosphorylation of mitochondrial proteins, thereby playing an essential role in ATP production. Has probably a preference for proteins phosphorylated on Ser and/or Thr residues compared to proteins phosphorylated on Tyr residues. Probably involved in regulation of insulin secretion in pancreatic beta cells (By similarity). |
Pathway | Phospholipid metabolism; phosphatidylglycerol biosynthesis; phosphatidylglycerol from CDP-diacylglycerol: step 2/2. |
Sequence Caution | Sequence=AAH14048.1; Type=Erroneous initiation; Evidence= ; Sequence=AAK07545.1; Type=Erroneous initiation; Evidence= ; |
Similarity | Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily. |
Similarity | Contains 1 tyrosine-protein phosphatase domain. |
Subcellular Location | Mitochondrion inner membrane . Note=Associated with the inner membrane. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006430 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
148224884 | RefSeq | NP_783859 | 201 | phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 isoform 1 |
221218988 | RefSeq | NP_001137456 | 151 | phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 isoform 2 |
Identical Sequences to LMP006430 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:148224884 | GenBank | EAW67905.1 | 201 | hCG25195, isoform CRA_b [Homo sapiens] |
GI:148224884 | GenBank | ACE86451.1 | 201 | protein tyrosine phosphatase, mitochondrial 1 protein, partial [synthetic construct] |
GI:148224884 | GenBank | ACE87127.1 | 201 | protein tyrosine phosphatase, mitochondrial 1 protein [synthetic construct] |
GI:148224884 | GenBank | ACN05271.1 | 201 | Sequence 130 from patent US 7485308 |
GI:148224884 | GenBank | ADQ32394.1 | 201 | protein tyrosine phosphatase, mitochondrial 1, partial [synthetic construct] |
GI:221218988 | RefSeq | XP_009458640.1 | 151 | PREDICTED: phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 isoform X2 [Pan troglodytes] |
GI:148224884 | SwissProt | Q8WUK0.1 | 201 | RecName: Full=Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1; AltName: Full=PTEN-like phosphatase; AltName: Full=Phosphoinositide lipid phosphatase; AltName: Full=Protein-tyrosine phosphatase mitochondrial 1; Flags: Precursor [Homo sapiens] |
Related Sequences to LMP006430 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:221218988 | EMBL | CAD57060.1 | 201 | unnamed protein product [Homo sapiens] |
GI:221218988 | GenBank | AAH20242.1 | 201 | PTPMT1 protein [Homo sapiens] |
GI:221218988 | GenBank | ACE86451.1 | 201 | protein tyrosine phosphatase, mitochondrial 1 protein, partial [synthetic construct] |
GI:221218988 | GenBank | ADQ32394.1 | 201 | protein tyrosine phosphatase, mitochondrial 1, partial [synthetic construct] |
GI:221218988 | RefSeq | NP_783859.1 | 201 | phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 isoform 1 [Homo sapiens] |
GI:148224884 | RefSeq | XP_002821851.1 | 201 | PREDICTED: phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 isoform X1 [Pongo abelii] |
GI:148224884 | RefSeq | XP_003279033.1 | 201 | PREDICTED: phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 [Nomascus leucogenys] |
GI:148224884 | RefSeq | XP_003313059.1 | 201 | PREDICTED: phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 isoform X1 [Pan troglodytes] |
GI:148224884 | RefSeq | XP_004051115.1 | 201 | PREDICTED: phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 [Gorilla gorilla gorilla] |
GI:148224884 | RefSeq | XP_005577987.1 | 201 | PREDICTED: phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 [Macaca fascicularis] |
GI:221218988 | RefSeq | XP_009244659.1 | 151 | PREDICTED: phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 isoform X2 [Pongo abelii] |
GI:148224884 | RefSeq | XP_010369435.1 | 201 | PREDICTED: phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 [Rhinopithecus roxellana] |