Gene/Proteome Database (LMPD)

LMPD ID
LMP006509
Gene ID
7533
Species
Homo sapiens (Human)
Gene Name
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta
Gene Symbol
YWHAH
Synonyms
YWHA1
Alternate Names
14-3-3 protein eta; 14-3-3 eta; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide
Chromosome
22
Map Location
22q12.3
Summary
This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and bovine orthologs. This gene contains a 7 bp repeat sequence in its 5' UTR, and changes in the number of this repeat have been associated with early-onset schizophrenia and psychotic bipolar disorder. [provided by RefSeq, Jun 2009]
Orthologs
View orthologs and multiple alignments for YWHAH

Proteins

14-3-3 protein eta
Refseq ID NP_003396
Protein GI 4507951
UniProt ID Q04917
mRNA ID NM_003405
Length 246
RefSeq Status REVIEWED
MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN

Gene Information

Entrez Gene ID
7533
Gene Name
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta
Gene Symbol
YWHAH
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 ISS:UniProtKB C cytoplasm
GO:0030659 TAS:Reactome C cytoplasmic vesicle membrane
GO:0005829 TAS:Reactome C cytosol
GO:0070062 IDA:UniProtKB C extracellular vesicular exosome
GO:0014704 IC:BHF-UCL C intercalated disc
GO:0005886 IDA:BHF-UCL C plasma membrane
GO:0019899 IPI:BHF-UCL F enzyme binding
GO:0035259 IPI:UniProtKB F glucocorticoid receptor binding
GO:0005159 ISS:UniProtKB F insulin-like growth factor receptor binding
GO:0044325 IPI:BHF-UCL F ion channel binding
GO:0019904 ISS:UniProtKB F protein domain specific binding
GO:0046982 IPI:BHF-UCL F protein heterodimerization activity
GO:0017080 IDA:BHF-UCL F sodium channel regulator activity
GO:0006915 TAS:Reactome P apoptotic process
GO:0006713 IDA:UniProtKB P glucocorticoid catabolic process
GO:0042921 IDA:UniProtKB P glucocorticoid receptor signaling pathway
GO:0006886 ISS:UniProtKB P intracellular protein transport
GO:0097193 TAS:Reactome P intrinsic apoptotic signaling pathway
GO:0086010 IDA:BHF-UCL P membrane depolarization during action potential
GO:0061024 TAS:Reactome P membrane organization
GO:0050774 ISS:UniProtKB P negative regulation of dendrite morphogenesis
GO:1900740 TAS:Reactome P positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway
GO:0045893 IDA:UniProtKB P positive regulation of transcription, DNA-templated
GO:0045664 ISS:UniProtKB P regulation of neuron differentiation
GO:2000649 IDA:BHF-UCL P regulation of sodium ion transmembrane transporter activity
GO:0002028 IDA:BHF-UCL P regulation of sodium ion transport
GO:0048167 ISS:UniProtKB P regulation of synaptic plasticity
GO:0021762 IEP:UniProt P substantia nigra development

KEGG Pathway Links

KEGG Pathway ID Description
hsa05169 Epstein-Barr virus infection
hsa04390 Hippo signaling pathway
hsa04151 PI3K-Akt signaling pathway
hsa05203 Viral carcinogenesis

Domain Information

InterPro Annotations

Accession Description
IPR000308 14-3-3 protein
IPR023409 14-3-3 protein, conserved site
IPR023410 14-3-3_domain

UniProt Annotations

Entry Information

Gene Name
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta
Protein Entry
1433F_HUMAN
UniProt ID
Q04917
Species
Human

Comments

Comment Type Description
Function Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Negatively regulates the kinase activity of PDPK1.
Interaction Q96B36:AKT1S1; NbExp=3; IntAct=EBI-306940, EBI-720593; Q8N5S9:CAMKK1; NbExp=5; IntAct=EBI-306940, EBI-6424030; P30305:CDC25B; NbExp=3; IntAct=EBI-306940, EBI-1051746; O94921:CDK14; NbExp=3; IntAct=EBI-306940, EBI-1043945; P67828:CSNK1A1 (xeno); NbExp=8; IntAct=EBI-306940, EBI-7540603; O60565:GREM1; NbExp=5; IntAct=EBI-306940, EBI-944395; P56524:HDAC4; NbExp=3; IntAct=EBI-306940, EBI-308629; Q14678-2:KANK1; NbExp=3; IntAct=EBI-306940, EBI-6173812; Q5S007:LRRK2; NbExp=3; IntAct=EBI-306940, EBI-5323863; Q7KZI7:MARK2; NbExp=8; IntAct=EBI-306940, EBI-516560; P27448:MARK3; NbExp=4; IntAct=EBI-306940, EBI-707595; Q96L34:MARK4; NbExp=6; IntAct=EBI-306940, EBI-302319; Q8TEW0:PARD3; NbExp=6; IntAct=EBI-306940, EBI-81968; Q9NPB6:PARD6A; NbExp=2; IntAct=EBI-306940, EBI-81876; Q9BYG5:PARD6B; NbExp=2; IntAct=EBI-306940, EBI-295391; Q9BYG4:PARD6G; NbExp=2; IntAct=EBI-306940, EBI-295417; P41743:PRKCI; NbExp=3; IntAct=EBI-306940, EBI-286199; P04049:RAF1; NbExp=3; IntAct=EBI-306940, EBI-365996; P61588:Rnd3 (xeno); NbExp=2; IntAct=EBI-306940, EBI-6930266;
Ptm Phosphorylated on Ser-59 by protein kinase C delta type catalytic subunit in a sphingosine-dependent fashion.
Similarity Belongs to the 14-3-3 family.
Subunit Homodimer (By similarity). Interacts with many nuclear hormone receptors and cofactors including AR, ESR1, ESR2, MC2R, NR3C1, NRIP1, PPARBP and THRA. Interacts with ABL1 (phosphorylated form); the interaction retains it in the cytoplasm. Interacts with ARHGEF28 and CDK16 (By similarity). Weakly interacts with CDKN1B. Interacts with GAB2. Interacts with KCNK18 in a phosphorylation- dependent manner. Interacts with SAMSN1 (By similarity). Interacts with the 'Ser-241' phosphorylated form of PDPK1. {ECO
Tissue Specificity Expressed mainly in the brain and present in other tissues albeit at lower levels.

Identical and Related Proteins

Unique RefSeq proteins for LMP006509 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
4507951 RefSeq NP_003396 246 14-3-3 protein eta

Identical Sequences to LMP006509 proteins

Reference Database Accession Length Protein Name
GI:4507951 GenBank JAB21034.1 246 14-3-3 protein eta [Callithrix jacchus]
GI:4507951 GenBank JAB21035.1 246 14-3-3 protein eta [Callithrix jacchus]
GI:4507951 GenBank JAB39292.1 246 14-3-3 protein eta [Callithrix jacchus]
GI:4507951 GenBank AGU04164.1 246 Sequence 55 from patent US 8476008
GI:4507951 GenBank AHD77460.1 246 Sequence 22593 from patent US 8586006
GI:4507951 RefSeq XP_007973739.1 246 PREDICTED: 14-3-3 protein eta isoform X2 [Chlorocebus sabaeus]

Related Sequences to LMP006509 proteins

Reference Database Accession Length Protein Name
GI:4507951 PDB 2C63 247 Chain A, 14-3-3 Protein Eta (human) Complexed To Peptide
GI:4507951 PDB 2C63 247 Chain B, 14-3-3 Protein Eta (human) Complexed To Peptide
GI:4507951 PDB 2C63 247 Chain C, 14-3-3 Protein Eta (human) Complexed To Peptide
GI:4507951 PDB 2C63 247 Chain D, 14-3-3 Protein Eta (human) Complexed To Peptide
GI:4507951 PDB 2C74 247 Chain A, 14-3-3 Protein Eta (Human) Complexed To Peptide
GI:4507951 PDB 2C74 247 Chain B, 14-3-3 Protein Eta (Human) Complexed To Peptide