Gene/Proteome Database (LMPD)
LMPD ID
LMP006517
Gene ID
Species
Homo sapiens (Human)
Gene Name
aldo-keto reductase family 7, member A2 (aflatoxin aldehyde reductase)
Gene Symbol
Synonyms
AFAR; AFAR1; AFB1-AR1; AKR7
Alternate Names
aflatoxin B1 aldehyde reductase member 2; AFB1-AR 1; HEL-S-166mP; SSA reductase; aldoketoreductase 7; AFB1 aldehyde reductase 1; succinic semialdehyde reductase; aflatoxin beta1 aldehyde reductase; epididymis secretory sperm binding protein Li 166mP
Chromosome
1
Map Location
1p36.13
EC Number
1.1.1.n11
Summary
The protein encoded by this gene belongs to the aldo/keto reductase (AKR) superfamily and AKR7 family, which are involved in the detoxification of aldehydes and ketones. The AKR7 family consists of 3 genes that are present in a cluster on the p arm of chromosome 1. This protein, thought to be localized in the golgi, catalyzes the NADPH-dependent reduction of succinic semialdehyde to the endogenous neuromodulator, gamma-hydroxybutyrate. It may also function as a detoxication enzyme in the reduction of aflatoxin B1 and 2-carboxybenzaldehyde. [provided by RefSeq, Oct 2011]
Orthologs
Proteins
| aflatoxin B1 aldehyde reductase member 2 | |
|---|---|
| Refseq ID | NP_003680 |
| Protein GI | 41327764 |
| UniProt ID | O43488 |
| mRNA ID | NM_003689 |
| Length | 359 |
| RefSeq Status | REVIEWED |
| MLSAASRVVSRAAVHCALRSPPPEARALAMSRPPPPRVASVLGTMEMGRRMDAPASAAAVRAFLERGHTELDTAFMYSDGQSETILGGLGLGLGGGDCRVKIATKANPWDGKSLKPDSVRSQLETSLKRLQCPQVDLFYLHAPDHGTPVEETLHACQRLHQEGKFVELGLSNYASWEVAEICTLCKSNGWILPTVYQGMYNATTRQVETELFPCLRHFGLRFYAYNPLAGGLLTGKYKYEDKDGKQPVGRFFGNSWAETYRNRFWKEHHFEAIALVEKALQAAYGASAPSVTSAALRWMYHHSQLQGAHGDAVILGMSSLEQLEQNLAATEEGPLEPAVVDAFNQAWHLVAHECPNYFR | |
Gene Information
Entrez Gene ID
Gene Name
aldo-keto reductase family 7, member A2 (aflatoxin aldehyde reductase)
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005794 | IEA:UniProtKB-KW | C | Golgi apparatus |
| GO:0070062 | IDA:UniProtKB | C | extracellular vesicular exosome |
| GO:0004032 | TAS:ProtInc | F | alditol:NADP+ 1-oxidoreductase activity |
| GO:0009055 | TAS:UniProtKB | F | electron carrier activity |
| GO:0019119 | IDA:UniProtKB | F | phenanthrene-9,10-epoxide hydrolase activity |
| GO:0005975 | TAS:ProtInc | P | carbohydrate metabolic process |
| GO:0006081 | TAS:ProtInc | P | cellular aldehyde metabolic process |
| GO:0044597 | IMP:UniProtKB | P | daunorubicin metabolic process |
| GO:0044598 | IMP:UniProtKB | P | doxorubicin metabolic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| hsa00980 | Metabolism of xenobiotics by cytochrome P450 |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_228214 | Aflatoxin activation and detoxification |
Domain Information
UniProt Annotations
Entry Information
Gene Name
aldo-keto reductase family 7, member A2 (aflatoxin aldehyde reductase)
Protein Entry
ARK72_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Biophysicochemical Properties | Kinetic parameters: KM=20 uM for succinic semialdehyde ; KM=17 uM for 2-carboxybenzaldehyde ; KM=8 uM for 9,10-phenanthrenequinone ; KM=102 uM for 1,2-naphthoquinone ; |
| Catalytic Activity | 4-hydroxybutanoate + NADP(+) = succinate semialdehyde + NADPH. |
| Caution | It is uncertain whether Met-1 or Met-30 is the initiator. |
| Function | Catalyzes the NADPH-dependent reduction of succinic semialdehyde to gamma-hydroxybutyrate. May have an important role in producing the neuromodulator gamma-hydroxybutyrate (GHB). Has broad substrate specificity. Has NADPH-dependent aldehyde reductase activity towards 2-carboxybenzaldehyde, 2- nitrobenzaldehyde and pyridine-2-aldehyde (in vitro). Can reduce 1,2-naphthoquinone and 9,10-phenanthrenequinone (in vitro). Can reduce the dialdehyde protein-binding form of aflatoxin B1 (AFB1) to the non-binding AFB1 dialcohol. May be involved in protection of liver against the toxic and carcinogenic effects of AFB1, a potent hepatocarcinogen. {ECO |
| Sequence Caution | Sequence=AAC52104.1; Type=Erroneous initiation; Evidence= ; Sequence=AAH04111.3; Type=Erroneous initiation; Evidence= ; Sequence=AAH10852.1; Type=Erroneous initiation; Evidence= ; Sequence=AAH11586.1; Type=Erroneous initiation; Evidence= ; Sequence=AAH12171.1; Type=Erroneous initiation; Evidence= ; Sequence=AAH13996.1; Type=Erroneous initiation; Evidence= ; Sequence=AAP36011.1; Type=Erroneous initiation; Evidence= ; Sequence=CAA76347.1; Type=Erroneous initiation; Evidence= ; Sequence=CAB72321.1; Type=Erroneous initiation; Evidence= ; |
| Similarity | Belongs to the aldo/keto reductase family. Aldo/keto reductase 2 subfamily. |
| Subcellular Location | Golgi apparatus . Cytoplasm . |
| Subunit | Homodimer. {ECO |
| Tissue Specificity | Detected in brain, liver, small intestine and testis, and at lower levels in heart, prostate, skeletal muscle and spleen. Detected in kidney proximal and distal tubules, endothelial cells lining the Bowman's capsules and some cysts. Detected at low levels in lung and pancreas (at protein level). Widely expressed. {ECO |
Identical and Related Proteins
Unique RefSeq proteins for LMP006517 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 41327764 | RefSeq | NP_003680 | 359 | aflatoxin B1 aldehyde reductase member 2 |
Identical Sequences to LMP006517 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:41327764 | GenBank | EAW94881.1 | 359 | aldo-keto reductase family 7, member A2 (aflatoxin aldehyde reductase) [Homo sapiens] |
| GI:41327764 | GenBank | ACJ13645.1 | 359 | epididymis secretory sperm binding protein Li 166mP [Homo sapiens] |
| GI:41327764 | SwissProt | O43488.3 | 359 | RecName: Full=Aflatoxin B1 aldehyde reductase member 2; AltName: Full=AFB1 aldehyde reductase 1; Short=AFB1-AR 1; AltName: Full=Aldoketoreductase 7; AltName: Full=Succinic semialdehyde reductase; Short=SSA reductase [Homo sapiens] |
| GI:41327764 | Third Party Genbank | DAA00088.1 | 359 | TPA_exp: aflatoxin B1-aldehyde reductase [Homo sapiens] |
Related Sequences to LMP006517 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:41327764 | GenBank | AAH07352.2 | 358 | AKR7A2 protein, partial [Homo sapiens] |
| GI:41327764 | PDB | 2BP1 | 360 | Chain A, Structure Of The Aflatoxin Aldehyde Reductase In Complex With Nadph |
| GI:41327764 | PDB | 2BP1 | 360 | Chain B, Structure Of The Aflatoxin Aldehyde Reductase In Complex With Nadph |
| GI:41327764 | PDB | 2BP1 | 360 | Chain C, Structure Of The Aflatoxin Aldehyde Reductase In Complex With Nadph |
| GI:41327764 | PDB | 2BP1 | 360 | Chain D, Structure Of The Aflatoxin Aldehyde Reductase In Complex With Nadph |
| GI:41327764 | RefSeq | XP_004024834.1 | 359 | PREDICTED: aflatoxin B1 aldehyde reductase member 2 [Gorilla gorilla gorilla] |