Gene/Proteome Database (LMPD)
LMPD ID
LMP006537
Gene ID
Species
Mus musculus (Mouse)
Gene Name
alpha 1,3-galactosyltransferase 2 (isoglobotriaosylceramide synthase)
Gene Symbol
Synonyms
Gm433; iGb3; iGb3S
Alternate Names
alpha-1,3-galactosyltransferase 2; iGb3 synthase
Chromosome
4
Map Location
4 D2.2|4
EC Number
2.4.1.87
Proteins
| alpha-1,3-galactosyltransferase 2 | |
|---|---|
| Refseq ID | NP_001009819 |
| Protein GI | 57528488 |
| UniProt ID | Q3V1N9 |
| mRNA ID | NM_001009819 |
| Length | 370 |
| RefSeq Status | VALIDATED |
| MALGTELGVSWPGSHGSCREQEGQRQRGPGKPTWGLSRAKKRLLWRFFLSAFGFLGLYHYRFIIIRLIEGSIPMGTCPTAIMPLPRDNFTGVLHHWARPEVLTCTSWGAPIIWDGTFDPHVAQQEARRRNLTIGLTVFAVGRYLEKYLEHFLVSAEQHFMVGQNVVYYVFTDRPEAVPYVALGQGRLLRAKPVQRERRWQDVSMARMPTLHEALGGQLGQEADFVFCLDVDQYFTGNFGPEVLADLVAQLHAWHYRWPRWLLPYERDKRSAAALSLSEGDFYYHAAVFGGSVAALLKLTAHCATGQQLDHKRGIEALWHDESHLNKFFWLNKPTKLLSPEFCWAEEIIWRREIHHPRLLWAPKEYTLVRN | |
Gene Information
Entrez Gene ID
Gene Name
alpha 1,3-galactosyltransferase 2 (isoglobotriaosylceramide synthase)
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005794 | ISS:UniProtKB | C | Golgi apparatus |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0031982 | ISS:UniProtKB | C | vesicle |
| GO:0047276 | IEA:UniProtKB-EC | F | N-acetyllactosaminide 3-alpha-galactosyltransferase activity |
| GO:0001962 | IGI:MGI | F | alpha-1,3-galactosyltransferase activity |
| GO:0046872 | IEA:UniProtKB-KW | F | metal ion binding |
| GO:0006688 | ISS:UniProtKB | P | glycosphingolipid biosynthetic process |
| GO:0030259 | ISS:UniProtKB | P | lipid glycosylation |
| GO:0006486 | IEA:UniProtKB-UniPathway | P | protein glycosylation |
Domain Information
UniProt Annotations
Entry Information
Gene Name
alpha 1,3-galactosyltransferase 2 (isoglobotriaosylceramide synthase)
Protein Entry
A3LT2_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q3V1N9-1; Sequence=Displayed; Name=2; IsoId=Q3V1N9-2; Sequence=VSP_054297; |
| Catalytic Activity | UDP-alpha-D-galactose + beta-D-galactosyl- (1->4)-beta-N-acetyl-D-glucosaminyl-R = UDP + alpha-D-galactosyl- (1->3)-beta-D-galactosyl-(1->4)-beta-N-acetylglucosaminyl-R. |
| Cofactor | Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence={ECO:0000250}; |
| Disruption Phenotype | Mice are fertile, develop normally and exhibit no overt behavioral abnormalities. However, compared to heterozygous mice they lack expression of the glycosphingolipid isoglobotrihexosylceramide (iGb3) in the dorsal root ganglion. {ECO:0000269|PubMed:17372206}. |
| Domain | The conserved DXD motif is involved in cofactor binding. The manganese ion interacts with the beta-phosphate group of UDP and may also have a role in catalysis (By similarity). {ECO:0000250}. |
| Function | Synthesizes the galactose-alpha(1,3)-galactose group on the glycosphingolipid isoglobotrihexosylceramide or isogloboside 3 (iGb3) by catalyzing the transfer of galactose from UDP-Galactose to its acceptor molecule Gal-beta-1,4-Glc-ceramide. Can also catalyze the addition of galactose to iGb3 itself to form polygalactose structures. Synthesis of iGb3 is the initial step in the formation of the isoglobo-series glycolipid pathway and is the precursor to isogloboside 4 (iGb4) and isoForssman glycolipids. Can glycosylate only lipids and not proteins and is solely responsible for initiating the synthesis of isoglobo-series glycosphingolipids. {ECO:0000269|PubMed:15539565, ECO:0000269|PubMed:16456004}. |
| Pathway | Protein modification; protein glycosylation. |
| Similarity | Belongs to the glycosyltransferase 6 family. {ECO:0000305}. |
| Subcellular Location | Golgi apparatus, Golgi stack membrane {ECO:0000305}; Single-pass type II membrane protein {ECO:0000305}. Note=Also found in numerous large vesicles throughout the cytoplasm of the soma. {ECO:0000250}. |
| Tissue Specificity | Thymus and lung. {ECO:0000269|PubMed:16456004}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006537 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 57528488 | RefSeq | NP_001009819 | 370 | alpha-1,3-galactosyltransferase 2 |
Identical Sequences to LMP006537 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:57528488 | DBBJ | BAE21111.1 | 370 | unnamed protein product [Mus musculus] |
| GI:57528488 | GenBank | AAS66769.1 | 370 | iGb3 synthase [Mus musculus] |
| GI:57528488 | GenBank | AAI40396.1 | 370 | Alpha 1,3-galactosyltransferase 2 (isoglobotriaosylceramide synthase), partial [synthetic construct] |
| GI:57528488 | GenBank | AAI46479.1 | 370 | Alpha 1,3-galactosyltransferase 2 (isoglobotriaosylceramide synthase) [synthetic construct] |
| GI:57528488 | SwissProt | Q3V1N9.1 | 370 | RecName: Full=Alpha-1,3-galactosyltransferase 2; Short=A3galt2; AltName: Full=Isoglobotriaosylceramide synthase; Short=iGb3 synthase; Short=iGb3S [Mus musculus] |
Related Sequences to LMP006537 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:57528488 | EMBL | CAQ52295.1 | 339 | alpha 1,3-galactosyltransferase 2 (isoglobotriaosylceramide synthase) [Mus musculus] |
| GI:57528488 | EMBL | CAQ52296.1 | 370 | alpha 1,3-galactosyltransferase 2 (isoglobotriaosylceramide synthase) [Mus musculus] |
| GI:57528488 | GenBank | EDL30228.1 | 333 | alpha 1,3-galactosyltransferase 2 (isoglobotriaosylceramide synthase), partial [Mus musculus] |
| GI:57528488 | RefSeq | XP_006502987.1 | 297 | PREDICTED: alpha-1,3-galactosyltransferase 2 isoform X1 [Mus musculus] |
| GI:57528488 | RefSeq | XP_006537025.1 | 297 | PREDICTED: alpha-1,3-galactosyltransferase 2 isoform X1 [Mus musculus] |
| GI:57528488 | RefSeq | XP_006996015.1 | 370 | PREDICTED: alpha-1,3-galactosyltransferase 2 isoform X1 [Peromyscus maniculatus bairdii] |