Gene/Proteome Database (LMPD)

LMPD ID
LMP006567
Gene ID
338521
Species
Mus musculus (Mouse)
Gene Name
fatty acid 2-hydroxylase
Gene Symbol
Fa2h
Synonyms
FAAH; Faxdc1; G630055L08Rik
Alternate Names
fatty acid 2-hydroxylase; fatty acid alpha-hydroxylase; fatty acid hydroxylase domain containing 1
Chromosome
8
Map Location
8 E1|8
EC Number
1.-.-.-

Proteins

fatty acid 2-hydroxylase
Refseq ID NP_835187
Protein GI 158517893
UniProt ID Q5MPP0
mRNA ID NM_178086
Length 372
RefSeq Status VALIDATED
MAPAPPPAASFTPAEVQRRLAAGACWVRRGASLYDLTSFVRHHPGGEQLLLARAGQDISADLDGPPHRHSDNARRWLEQYYVGELRADPQDPTENGAVASAETQKTDPALEPQFKVVDWDKDLVDWQKPLLWQVGHLGEKYDEWVHQPVARPIRLFHSDLIEAFSKTVWYSVPIIWVPLVLYLSWSYYRTLTQDNIRLFASLTREYSMMMPESVFIGLFVLGMLFWTFVEYVIHRFLFHMKPPSNSHYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLVIAFFYVFLRLILPETVGGIIFAGGLLGYVLYDMTHYYLHFGSPHKGSYLYNMKAHHVKHHFEYQKSGFGISTKLWDYFFHTLIPEEAHPKMQ

Gene Information

Entrez Gene ID
338521
Gene Name
fatty acid 2-hydroxylase
Gene Symbol
Fa2h
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IDA:MGI C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0080132 IDA:MGI F fatty acid alpha-hydroxylase activity
GO:0020037 IEA:InterPro F heme binding
GO:0005506 IEA:InterPro F iron ion binding
GO:0032286 IMP:MGI P central nervous system myelin maintenance
GO:0006633 IEA:UniProtKB-KW P fatty acid biosynthetic process
GO:0006631 IDA:MGI P fatty acid metabolic process
GO:0030258 IDA:MGI P lipid modification
GO:0032287 IMP:MGI P peripheral nervous system myelin maintenance
GO:0042127 IMP:MGI P regulation of cell proliferation
GO:0042634 IMP:MGI P regulation of hair cycle
GO:0001949 IMP:MGI P sebaceous gland cell differentiation
GO:0006665 IEA:InterPro P sphingolipid metabolic process

Domain Information

InterPro Annotations

Accession Description
IPR018506 Cytochrome b5, heme-binding site
IPR001199 Cytochrome b5-like heme/steroid binding domain
IPR006694 Fatty_acid_hydroxylase
IPR014430 Inositolphosphorylceramide-B hydroxylase

UniProt Annotations

Entry Information

Gene Name
fatty acid 2-hydroxylase
Protein Entry
FA2H_MOUSE
UniProt ID
Q5MPP0
Species
Mouse

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q5MPP0-1; Sequence=Displayed; Name=2; IsoId=Q5MPP0-2; Sequence=VSP_029838; Name=3; IsoId=Q5MPP0-3; Sequence=VSP_029837;
Cofactor Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence={ECO:0000250};
Developmental Stage Levels increase rapidly in brains from newborns, in parallel with myelination in the central nervous system. Present at very low levels in newborns. Levels are highest at 2 to 3 weeks, and then decrease slightly to reach an constant, intermediate level after 4 months. Constitutively expressed at an intermediate level throughout adult life. {ECO:0000269|PubMed:15658937, ECO:0000269|PubMed:16998236}.
Domain The histidine box domains may contain the active site and/or be involved in metal ion binding.
Function Required for alpha-hydroxylation of free fatty acids and the formation of alpha-hydroxylated sphingolipids. {ECO:0000269|PubMed:15658937, ECO:0000269|PubMed:16998236}.
Sequence Caution Sequence=AAH46985.1; Type=Frameshift; Positions=34; Evidence={ECO:0000305}; Sequence=AAI11913.1; Type=Erroneous initiation; Evidence={ECO:0000305};
Similarity Belongs to the sterol desaturase family. SCS7 subfamily. {ECO:0000305}.
Similarity Contains 1 cytochrome b5 heme-binding domain. {ECO:0000255|PROSITE-ProRule:PRU00279}.
Subcellular Location Endoplasmic reticulum membrane {ECO:0000269|PubMed:15658937}; Multi-pass membrane protein {ECO:0000269|PubMed:15658937}. Microsome membrane {ECO:0000269|PubMed:15658937}; Multi-pass membrane protein {ECO:0000269|PubMed:15658937}.
Tissue Specificity Detected in brain and skin (at protein level). Detected in brain white matter, cerebellum forebrain, stomach, kidney, skin and testis. Detected in oligodendrocytes. {ECO:0000269|PubMed:15658937, ECO:0000269|PubMed:16998236}.

Identical and Related Proteins

Unique RefSeq proteins for LMP006567 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
158517893 RefSeq NP_835187 372 fatty acid 2-hydroxylase

Identical Sequences to LMP006567 proteins

Reference Database Accession Length Protein Name
GI:158517893 DBBJ BAE36428.1 372 unnamed protein product [Mus musculus]
GI:158517893 GenBank AAV70494.1 372 fatty acid 2-hydroxylase [Mus musculus]
GI:158517893 GenBank AAI28081.1 372 Fatty acid 2-hydroxylase [Mus musculus]
GI:158517893 GenBank AAI28082.1 372 Fatty acid 2-hydroxylase [Mus musculus]
GI:158517893 GenBank EDL11497.1 372 fatty acid 2-hydroxylase, isoform CRA_a [Mus musculus]
GI:158517893 SwissProt Q5MPP0.1 372 RecName: Full=Fatty acid 2-hydroxylase; AltName: Full=Fatty acid alpha-hydroxylase [Mus musculus]

Related Sequences to LMP006567 proteins

Reference Database Accession Length Protein Name
GI:158517893 DBBJ BAC41174.1 372 unnamed protein product [Mus musculus]
GI:158517893 GenBank ERE78277.1 372 fatty acid 2-hydroxylase-like protein [Cricetulus griseus]
GI:158517893 RefSeq NP_001129055.1 372 fatty acid 2-hydroxylase [Rattus norvegicus]
GI:158517893 RefSeq XP_005073102.1 372 PREDICTED: fatty acid 2-hydroxylase [Mesocricetus auratus]
GI:158517893 RefSeq XP_006974151.1 372 PREDICTED: fatty acid 2-hydroxylase [Peromyscus maniculatus bairdii]
GI:158517893 SwissProt Q2LAM0.2 372 RecName: Full=Fatty acid 2-hydroxylase; AltName: Full=Fatty acid alpha-hydroxylase [Rattus norvegicus]