Gene/Proteome Database (LMPD)
LMPD ID
LMP006576
Gene ID
Species
Mus musculus (Mouse)
Gene Name
steroid 5 alpha-reductase 1
Gene Symbol
Synonyms
0610031P22Rik; 4930435F02Rik; S5AR 1; Srd5a-1
Alternate Names
3-oxo-5-alpha-steroid 4-dehydrogenase 1; SR type 1; type 1 5alpha-reductase; steroid 5-alpha-reductase 1
Chromosome
13
Map Location
13 C1|13 35.55 cM
EC Number
1.3.1.22
Proteins
| 3-oxo-5-alpha-steroid 4-dehydrogenase 1 | |
|---|---|
| Refseq ID | NP_780492 |
| Protein GI | 87044895 |
| UniProt ID | Q68FF9 |
| mRNA ID | NM_175283 |
| Length | 255 |
| RefSeq Status | VALIDATED |
| MELDELRLLDALVYLEGFLAFVAFVGLQMVGSSYGRYSSQWSGRRVPARPAWFLQELPSMAWPLYECIRPAAARLGNLPNRVLLAMFLIHYVQRTLVFPVLIRGGKPTLLFTFVLAFLFCTLNGYLQSRYLSQFAVYAEDWVTHPCFLTGFALWLVGMVINIHSDHILRNLRKPGETGYKIPRGGLFEYVSSANYFGELVEWCGFALASWSLQGVVFALFTLCALFTRARQHHQWYLEKFEDYPKTRKILIPFLL | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0003865 | ISS:UniProtKB | F | 3-oxo-5-alpha-steroid 4-dehydrogenase activity |
| GO:0047751 | IEA:UniProtKB-EC | F | cholestenone 5-alpha-reductase activity |
| GO:0006702 | IMP:MGI | P | androgen biosynthetic process |
| GO:0030154 | IEA:UniProtKB-KW | P | cell differentiation |
| GO:0007548 | IEA:UniProtKB-KW | P | sex differentiation |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko00140 | Steroid hormone biosynthesis |
| mmu00140 | Steroid hormone biosynthesis |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | A 3-oxo-5-alpha-steroid + NADP(+) = a 3-oxo- Delta(4)-steroid + NADPH. |
| Function | Converts testosterone into 5-alpha-dihydrotestosterone and progesterone or corticosterone into their corresponding 5- alpha-3-oxosteroids. It plays a central role in sexual differentiation and androgen physiology (By similarity). {ECO:0000250}. |
| Similarity | Belongs to the steroid 5-alpha reductase family. {ECO:0000305}. |
| Subcellular Location | Microsome membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. Endoplasmic reticulum membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006576 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 87044895 | RefSeq | NP_780492 | 255 | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
Identical Sequences to LMP006576 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:87044895 | GenBank | AAH79863.1 | 255 | Steroid 5 alpha-reductase 1 [Mus musculus] |
Related Sequences to LMP006576 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:87044895 | GenBank | AAA42102.1 | 255 | steroid 5 alpha-reductase (EC 1.3.99.5) [Rattus norvegicus] |
| GI:87044895 | GenBank | AAA71247.1 | 255 | Sequence 2 from patent US 5422262 |
| GI:87044895 | GenBank | AAH94503.1 | 255 | Steroid 5 alpha-reductase 1 [Mus musculus] |
| GI:87044895 | GenBank | EDL37018.1 | 255 | steroid 5 alpha-reductase 1 [Mus musculus] |
| GI:87044895 | RefSeq | NP_058766.2 | 255 | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 [Rattus norvegicus] |
| GI:87044895 | SwissProt | Q68FF9.2 | 255 | RecName: Full=3-oxo-5-alpha-steroid 4-dehydrogenase 1; AltName: Full=SR type 1; AltName: Full=Steroid 5-alpha-reductase 1; Short=S5AR 1 [Mus musculus] |