Gene/Proteome Database (LMPD)
LMPD ID
LMP006576
Gene ID
Species
Mus musculus (Mouse)
Gene Name
steroid 5 alpha-reductase 1
Gene Symbol
Synonyms
0610031P22Rik; 4930435F02Rik; S5AR 1; Srd5a-1
Alternate Names
3-oxo-5-alpha-steroid 4-dehydrogenase 1; SR type 1; type 1 5alpha-reductase; steroid 5-alpha-reductase 1
Chromosome
13
Map Location
13 C1|13 35.55 cM
EC Number
1.3.1.22
Proteins
3-oxo-5-alpha-steroid 4-dehydrogenase 1 | |
---|---|
Refseq ID | NP_780492 |
Protein GI | 87044895 |
UniProt ID | Q68FF9 |
mRNA ID | NM_175283 |
Length | 255 |
RefSeq Status | VALIDATED |
MELDELRLLDALVYLEGFLAFVAFVGLQMVGSSYGRYSSQWSGRRVPARPAWFLQELPSMAWPLYECIRPAAARLGNLPNRVLLAMFLIHYVQRTLVFPVLIRGGKPTLLFTFVLAFLFCTLNGYLQSRYLSQFAVYAEDWVTHPCFLTGFALWLVGMVINIHSDHILRNLRKPGETGYKIPRGGLFEYVSSANYFGELVEWCGFALASWSLQGVVFALFTLCALFTRARQHHQWYLEKFEDYPKTRKILIPFLL |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0003865 | ISS:UniProtKB | F | 3-oxo-5-alpha-steroid 4-dehydrogenase activity |
GO:0047751 | IEA:UniProtKB-EC | F | cholestenone 5-alpha-reductase activity |
GO:0006702 | IMP:MGI | P | androgen biosynthetic process |
GO:0030154 | IEA:UniProtKB-KW | P | cell differentiation |
GO:0007548 | IEA:UniProtKB-KW | P | sex differentiation |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
ko00140 | Steroid hormone biosynthesis |
mmu00140 | Steroid hormone biosynthesis |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Catalytic Activity | A 3-oxo-5-alpha-steroid + NADP(+) = a 3-oxo- Delta(4)-steroid + NADPH. |
Function | Converts testosterone into 5-alpha-dihydrotestosterone and progesterone or corticosterone into their corresponding 5- alpha-3-oxosteroids. It plays a central role in sexual differentiation and androgen physiology (By similarity). {ECO:0000250}. |
Similarity | Belongs to the steroid 5-alpha reductase family. {ECO:0000305}. |
Subcellular Location | Microsome membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. Endoplasmic reticulum membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006576 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
87044895 | RefSeq | NP_780492 | 255 | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
Identical Sequences to LMP006576 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:87044895 | GenBank | AAH79863.1 | 255 | Steroid 5 alpha-reductase 1 [Mus musculus] |
Related Sequences to LMP006576 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:87044895 | GenBank | AAA42102.1 | 255 | steroid 5 alpha-reductase (EC 1.3.99.5) [Rattus norvegicus] |
GI:87044895 | GenBank | AAA71247.1 | 255 | Sequence 2 from patent US 5422262 |
GI:87044895 | GenBank | AAH94503.1 | 255 | Steroid 5 alpha-reductase 1 [Mus musculus] |
GI:87044895 | GenBank | EDL37018.1 | 255 | steroid 5 alpha-reductase 1 [Mus musculus] |
GI:87044895 | RefSeq | NP_058766.2 | 255 | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 [Rattus norvegicus] |
GI:87044895 | SwissProt | Q68FF9.2 | 255 | RecName: Full=3-oxo-5-alpha-steroid 4-dehydrogenase 1; AltName: Full=SR type 1; AltName: Full=Steroid 5-alpha-reductase 1; Short=S5AR 1 [Mus musculus] |