Gene/Proteome Database (LMPD)
LMPD ID
LMP006605
Gene ID
Species
Mus musculus (Mouse)
Gene Name
UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4
Gene Symbol
Synonyms
1010001G17Rik; BGnT-4
Alternate Names
UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4; beta3Gn-T4; beta-1,3-Gn-T4
Chromosome
5
Map Location
5 F|5
EC Number
2.4.1.-
Proteins
UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 precursor | |
---|---|
Refseq ID | NP_941013 |
Protein GI | 148539883 |
UniProt ID | Q1RLK6 |
mRNA ID | NM_198611 |
Length | 350 |
RefSeq Status | VALIDATED |
MLPRLGCVLFCSLVVLLLSCLLLLKERIPAGSSKAHQQFLALPRSHHSQCSPNLTVVNTSLSLPSRHRLFLTYRHCRNFSILLEPSECARDTFLLLVIKSQPAHIEQRSAIRSTWGRAGSWARGRQLKLVFLLGVAGPVPPAQLLVYESWQFDDILQWDFAEDFFNLTLKELHVQRWIAAACTQAHFILKGDDDVFIHVPNVLEFLEGWDPAQDFLVGDVIRLARPNRNTKVKYFIPFSMYRARHYPPYAGGGGYVMSQATVRHLHMAMEEAELFPIDDVFVGMCLRKLGVTPIHHAGFKTFGIQQPLNPRDPCLYKGLLLVHRLSPLEMWTMWALVTDERLKCAATHKP | |
sig_peptide: 1..19 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2077 peptide sequence: MLPRLGCVLFCSLVVLLLS |
Gene Information
Entrez Gene ID
Gene Name
UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005794 | IEA:UniProtKB-KW | C | Golgi apparatus |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0008378 | IEA:InterPro | F | galactosyltransferase activity |
GO:0006486 | IEA:UniProtKB-UniPathway | P | protein glycosylation |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
mmu00601 | Glycosphingolipid biosynthesis - lacto and neolacto series |
mmu01100 | Metabolic pathways |
REACTOME Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR002659 | Glycosyl transferase, family 31 |
UniProt Annotations
Entry Information
Gene Name
UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4
Protein Entry
B3GN4_MOUSE
UniProt ID
Species
Mouse
Comments
Comment Type | Description |
---|---|
Function | Has a beta-1,3-N-acetylglucosaminyltransferase activity for type 2 oligosaccharides. {ECO:0000250}. |
Pathway | Protein modification; protein glycosylation. |
Similarity | Belongs to the glycosyltransferase 31 family. {ECO:0000305}. |
Subcellular Location | Golgi apparatus membrane {ECO:0000250}; Single-pass type II membrane protein {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006605 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
148539883 | RefSeq | NP_941013 | 350 | UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 precursor |
Identical Sequences to LMP006605 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:148539883 | RefSeq | XP_006530374.1 | 350 | PREDICTED: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 isoform X1 [Mus musculus] |
GI:148539883 | RefSeq | XP_006530375.1 | 350 | PREDICTED: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 isoform X2 [Mus musculus] |
GI:148539883 | RefSeq | XP_006530376.1 | 350 | PREDICTED: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 isoform X3 [Mus musculus] |
GI:148539883 | SwissProt | Q1RLK6.2 | 350 | RecName: Full=UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4; Short=BGnT-4; Short=Beta-1,3-Gn-T4; Short=Beta-1,3-N-acetylglucosaminyltransferase 4; Short=Beta3Gn-T4 [Mus musculus] |
Related Sequences to LMP006605 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:148539883 | GenBank | AAK68856.1 | 350 | beta1,3 N-acetylglucosaminyltransferase-4 [Mus musculus] |
GI:148539883 | GenBank | AAI14988.1 | 350 | UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 [Mus musculus] |
GI:148539883 | GenBank | AAI15756.1 | 350 | UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 [Mus musculus] |
GI:148539883 | GenBank | EDL19632.1 | 350 | UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 [Mus musculus] |
GI:148539883 | GenBank | EDM13635.1 | 349 | UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 (predicted) [Rattus norvegicus] |
GI:148539883 | RefSeq | XP_006249398.1 | 349 | PREDICTED: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 isoform X1 [Rattus norvegicus] |