Gene/Proteome Database (LMPD)
LMPD ID
LMP006612
Gene ID
Species
Homo sapiens (Human)
Gene Name
GNAS complex locus
Gene Symbol
Synonyms
AHO; C20orf45; GNAS1; GPSA; GSA; GSP; NESP; PHP1A; PHP1B; PHP1C; POH
Chromosome
20
Map Location
20q13.3
Summary
This locus has a highly complex imprinted expression pattern. It gives rise to maternally, paternally, and biallelically expressed transcripts that are derived from four alternative promoters and 5' exons. Some transcripts contain a differentially methylated region (DMR) at their 5' exons, and this DMR is commonly found in imprinted genes and correlates with transcript expression. An antisense transcript is produced from an overlapping locus on the opposite strand. One of the transcripts produced from this locus, and the antisense transcript, are paternally expressed noncoding RNAs, and may regulate imprinting in this region. In addition, one of the transcripts contains a second overlapping ORF, which encodes a structurally unrelated protein - Alex. Alternative splicing of downstream exons is also observed, which results in different forms of the stimulatory G-protein alpha subunit, a key element of the classical signal transduction pathway linking receptor-ligand interactions with the activation of adenylyl cyclase and a variety of cellular reponses. Multiple transcript variants encoding different isoforms have been found for this gene. Mutations in this gene result in pseudohypoparathyroidism type 1a, pseudohypoparathyroidism type 1b, Albright hereditary osteodystrophy, pseudopseudohypoparathyroidism, McCune-Albright syndrome, progressive osseus heteroplasia, polyostotic fibrous dysplasia of bone, and some pituitary tumors. [provided by RefSeq, Aug 2012]
Orthologs
Proteins
protein ALEX isoform Alex | |
---|---|
Refseq ID | NP_001070958 |
Protein GI | 117938768 |
UniProt ID | P63092 |
mRNA ID | NM_001077490 |
Length | 626 |
RefSeq Status | REVIEWED |
MMARPVDPQRSPDPTFRSSTRHSGKLEPMEATAHLLRKQCPSRLNSPAWEASGLHWSSLDSPVGSMQALRPSAQHSWSPEPSVVPDQAWEDTALHQKKLCPLSLTSLPREAAVNFSYRSQTLLQEAQVLQGSPELLPRSPKPSGLQRLAPEEATALPLRRLCHLSLMEKDLGTTAHPRGFPELSHKSTAAASSRQSRPRVRSASLPPRTRLPSGSQAPSAAHPKRLSDLLLTSRAAAPGWRSPDPRSRLAAPPLGSTTLPSTWTAPQSRLTARPSRSPEPQIRESEQRDPQLRRKQQRWKEPLMPRREEKYPLRGTDPLPPGQPQRIPLPGQPLQPQPILTPGQPQKIPTPGQHQPILTPGHSQPIPTPGQPLPPQPIPTPGRPLTPQPIPTPGRPLTPQPIQMPGRPLRLPPPLRLLRPGQPMSPQLRQTQGLPLPQPLLPPGQPKSAGRPLQPLPPGPDARSISDPPAPRSRLPIRLLRGLLARLPGGASPRAAAAAACTTMKGWPAATMTPAETSPTMGPPDASAGFSIGEIAAAESPSATYSATFSCKPSGAASVDLRVPSPKPRALSRSRRYPWRRSADRCAKKPWRSGPRSAQRRNAVSSSTNNSRTKRWATCVRTACCF |
protein GNAS isoform GNASL | |
---|---|
Refseq ID | NP_000507 |
Protein GI | 4504047 |
UniProt ID | P63092 |
mRNA ID | NM_000516 |
Length | 394 |
RefSeq Status | REVIEWED |
MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSDGEKATKVQDIKNNLKEAIETIVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL |
protein GNAS isoform GNASS | |
---|---|
Refseq ID | NP_536351 |
Protein GI | 18426900 |
UniProt ID | P63092 |
mRNA ID | NM_080426 |
Length | 380 |
RefSeq Status | REVIEWED |
MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL |
protein GNAS isoform XLas | |
---|---|
Refseq ID | NP_536350 |
Protein GI | 117938759 |
UniProt ID | P63092 |
mRNA ID | NM_080425 |
Length | 1037 |
RefSeq Status | REVIEWED |
MGVRNCLYGNNMSGQRDIPPEIGEQPEQPPLEAPGAAAPGAGPSPAEEMETEPPHNEPIPVENDGEACGPPEVSRPNFQVLNPAFREAGAHGSYSPPPEEAMPFEAEQPSLGGFWPTLEQPGFPSGVHAGLEAFGPALMEPGAFSGARPGLGGYSPPPEEAMPFEFDQPAQRGCSQLLLQVPDLAPGGPGAAGVPGAPPEEPQALRPAKAGSRGGYSPPPEETMPFELDGEGFGDDSPPPGLSRVIAQVDGSSQFAAVAASSAVRLTPAANAPPLWVPGAIGSPSQEAVRPPSNFTGSSPWMEISGPPFEIGSAPAGVDDTPVNMDSPPIALDGPPIKVSGAPDKRERAERPPVEEEAAEMEGAADAAEGGKVPSPGYGSPAAGAASADTAARAAPAAPADPDSGATPEDPDSGTAPADPDSGAFAADPDSGAAPAAPADPDSGAAPDAPADPDSGAAPDAPADPDAGAAPEAPAAPAAAETRAAHVAPAAPDAGAPTAPAASATRAAQVRRAASAAPASGARRKIHLRPPSPEIQAADPPTPRPTRASAWRGKSESSRGRRVYYDEGVASSDDDSSGDESDDGTSGCLRWFQHRRNRRRRKPQRNLLRNFLVQAFGGCFGRSESPQPKASRSLKVKKVPLAEKRRQMRKEALEKRAQKRAEKKRSKLIDKQLQDEKMGYMCTHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSDGEKATKVQDIKNNLKEAIETIVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL |
protein GNAS isoform f | |
---|---|
Refseq ID | NP_001070956 |
Protein GI | 117938762 |
UniProt ID | P63092 |
mRNA ID | NM_001077488 |
Length | 395 |
RefSeq Status | REVIEWED |
MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSDGSEKATKVQDIKNNLKEAIETIVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL |
protein GNAS isoform g | |
---|---|
Refseq ID | NP_001070957 |
Protein GI | 117938765 |
UniProt ID | P63092 |
mRNA ID | NM_001077489 |
Length | 379 |
RefSeq Status | REVIEWED |
MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGDEKATKVQDIKNNLKEAIETIVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL |
protein NESP55 isoform NESP55 | |
---|---|
Refseq ID | NP_057676 |
Protein GI | 7706589 |
UniProt ID | O95467 |
mRNA ID | NM_016592 |
Length | 245 |
RefSeq Status | REVIEWED |
MDRRSRAQQWRRARHNYNDLCPPIGRRAATALLWLSCSIALLRALATSNARAQQRAAAQQRRSFLNAHHRSGAQVFPESPESESDHEHEEADLELSLPECLEYEEEFDYETESETESEIESETDFETEPETAPTTEPETEPEDDRGPVVPKHSTFGQSLTQRLHALKLRSPDASPSRAPPSTQEPQSPREGEELKPEDKDPRDPEESKEPKEEKQRRRCKPKKPTRRDASPESPSKKGPIPIRRH |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005737 | IDA:UniProt | C | cytoplasm |
GO:0031410 | IEA:UniProtKB-KW | C | cytoplasmic vesicle |
GO:0005576 | IEA:UniProtKB-KW | C | extracellular region |
GO:0005634 | IDA:UniProt | C | nucleus |
GO:0048471 | IDA:UniProt | C | perinuclear region of cytoplasm |
GO:0007565 | NAS:UniProtKB | P | female pregnancy |
GO:0040015 | ISS:UniProt | P | negative regulation of multicellular organism growth |
GO:0009306 | NAS:UniProtKB | P | protein secretion |
GO:0071107 | IMP:UniProt | P | response to parathyroid hormone |
KEGG Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR009434 | Neuroendocrine-specific golgi P55 |
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Alternative Products | Event=Alternative splicing; Named isoforms=7; Name=Nesp55 {ECO |
Disease | ACTH-independent macronodular adrenal hyperplasia 1 (AIMAH1) [MIM |
Disease | GNAS hyperfunction (GNASHYP) [MIM |
Disease | Pseudohypoparathyroidism 1B (PHP1B) [MIM |
Miscellaneous | The GNAS locus is imprinted in a complex manner, giving rise to distinct paternally, maternally and biallelically expressed proteins. The XLas isoforms are paternally derived, the Gnas isoforms are biallelically derived and the Nesp55 isoforms are maternally derived. |
Miscellaneous | This protein is produced by a bicistronic gene which also produces the ALEX protein from an overlapping reading frame. |
Ptm | Binds keratan sulfate chains. |
Ptm | May be proteolytically processed to give rise to a number of active peptides. |
Similarity | Belongs to the NESP55 family. |
Subcellular Location | Cytoplasmic vesicle, secretory vesicle {ECO |
Identical and Related Proteins
Unique RefSeq proteins for LMP006612 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
117938768 | RefSeq | NP_001070958 | 626 | protein ALEX isoform Alex |
4504047 | RefSeq | NP_000507 | 394 | protein GNAS isoform GNASL |
18426900 | RefSeq | NP_536351 | 380 | protein GNAS isoform GNASS |
117938759 | RefSeq | NP_536350 | 1037 | protein GNAS isoform XLas |
117938762 | RefSeq | NP_001070956 | 395 | protein GNAS isoform f |
117938765 | RefSeq | NP_001070957 | 379 | protein GNAS isoform g |
7706589 | RefSeq | NP_057676 | 245 | protein NESP55 isoform NESP55 |
Identical Sequences to LMP006612 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:7706589 | DBBJ | BAG37135.1 | 245 | unnamed protein product [Homo sapiens] |
GI:117938765 | EMBL | CAN13156.1 | 379 | GNAS complex locus [Sus scrofa] |
GI:117938759 | GenBank | EAW75462.1 | 1037 | GNAS complex locus, isoform CRA_f [Homo sapiens] |
GI:117938759 | GenBank | EAW75469.1 | 1037 | GNAS complex locus, isoform CRA_f [Homo sapiens] |
GI:117938762 | GenBank | ADQ32746.1 | 395 | GNAS complex locus, partial [synthetic construct] |
GI:7706589 | GenBank | AED39314.1 | 245 | Sequence 1437 from patent US 7883858 |
GI:4504047 | GenBank | AFA68047.1 | 394 | Sequence 308 from patent US 8101396 |
GI:18426900 | GenBank | AFA68075.1 | 380 | Sequence 336 from patent US 8101396 |
GI:4504047 | GenBank | AFA68076.1 | 394 | Sequence 337 from patent US 8101396 |
GI:117938765 | GenBank | AFJ70627.1 | 379 | protein ALEX isoform g [Macaca mulatta] |
GI:18426900 | GenBank | AFJ70628.1 | 380 | protein ALEX GNASS [Macaca mulatta] |
GI:117938762 | GenBank | JAB11847.1 | 395 | protein GNAS isoform f [Callithrix jacchus] |
GI:18426900 | GenBank | JAB11848.1 | 380 | protein GNAS isoform GNASS [Callithrix jacchus] |
GI:117938762 | GenBank | JAB11849.1 | 395 | protein GNAS isoform f [Callithrix jacchus] |
GI:4504047 | GenBank | AGY18218.1 | 394 | Sequence 7 from patent US 8546536 |
GI:117938762 | GenBank | AGY18229.1 | 395 | Sequence 18 from patent US 8546536 |
GI:117938765 | GenBank | AGY18230.1 | 379 | Sequence 19 from patent US 8546536 |
GI:18426900 | GenBank | AGY18231.1 | 380 | Sequence 20 from patent US 8546536 |
GI:4504047 | GenBank | AHD72166.1 | 394 | Sequence 7664 from patent US 8586006 |
GI:7706589 | GenBank | AHD72167.1 | 245 | Sequence 7665 from patent US 8586006 |
GI:18426900 | GenBank | AHD72169.1 | 380 | Sequence 7667 from patent US 8586006 |
GI:117938762 | GenBank | AIC48848.1 | 395 | GNAS, partial [synthetic construct] |
GI:4504047 | GenBank | AIC63012.1 | 394 | GNAS, partial [synthetic construct] |
GI:117938762 | RefSeq | NP_001165455.1 | 395 | guanine nucleotide-binding protein G(s) subunit alpha isoform f [Sus scrofa] |
GI:117938765 | RefSeq | NP_001165456.1 | 379 | guanine nucleotide-binding protein G(s) subunit alpha isoform g [Sus scrofa] |
GI:7706589 | RefSeq | XP_003806229.1 | 245 | PREDICTED: neuroendocrine secretory protein 55 [Pan paniscus] |
GI:7706589 | RefSeq | XP_004062492.1 | 245 | PREDICTED: guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas [Gorilla gorilla gorilla] |
GI:7706589 | RefSeq | XP_004062493.1 | 245 | PREDICTED: guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas [Gorilla gorilla gorilla] |
GI:117938765 | RefSeq | XP_003277551.2 | 379 | PREDICTED: guanine nucleotide-binding protein G(s) subunit alpha isoforms short [Nomascus leucogenys] |
GI:4504047 | RefSeq | XP_007185299.1 | 394 | PREDICTED: guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas-like isoform X1 [Balaenoptera acutorostrata scammoni] |
GI:18426900 | RefSeq | XP_007185300.1 | 380 | PREDICTED: guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas-like isoform X2 [Balaenoptera acutorostrata scammoni] |
GI:117938765 | RefSeq | XP_007185301.1 | 379 | PREDICTED: guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas-like isoform X3 [Balaenoptera acutorostrata scammoni] |
GI:117938768 | SwissProt | P84996.1 | 626 | RecName: Full=Protein ALEX; AltName: Full=Alternative gene product encoded by XL-exon [Homo sapiens] |
GI:117938759 | SwissProt | Q5JWF2.2 | 1037 | RecName: Full=Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas; AltName: Full=Adenylate cyclase-stimulating G alpha protein; AltName: Full=Extra large alphas protein; Short=XLalphas [Homo sapiens] |
Related Sequences to LMP006612 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:18426900 | DBBJ | BAE27636.1 | 380 | unnamed protein product [Mus musculus] |
GI:7706589 | EMBL | CAC32401.1 | 253 | unnamed protein product, partial [Homo sapiens] |
GI:117938768 | EMBL | CAN13151.1 | 564 | GNAS complex locus [Sus scrofa] |
GI:117938765 | GenBank | AAM12612.1 | 380 | guanine nucleotide binding protein alpha s short [Homo sapiens] |
GI:4504047 | GenBank | AAN93812.1 | 394 | Sequence 106 from patent US 6462178 |
GI:4504047 | GenBank | AAP36911.1 | 395 | Homo sapiens GNAS complex locus, partial [synthetic construct] |
GI:18426900 | GenBank | AAH61496.1 | 380 | GNAS (guanine nucleotide binding protein, alpha stimulating) complex locus [Mus musculus] |
GI:7706589 | GenBank | AAR45541.1 | 253 | Sequence 2 from patent US 6608025 |
GI:117938765 | GenBank | AAH66923.1 | 379 | GNAS complex locus [Homo sapiens] |
GI:4504047 | GenBank | AAX29031.1 | 395 | GNAS complex locus, partial [synthetic construct] |
GI:4504047 | GenBank | AAX29032.1 | 395 | GNAS complex locus, partial [synthetic construct] |
GI:117938762 | GenBank | ABL20575.1 | 394 | Sequence 13 from patent US 7125660 |
GI:117938762 | GenBank | EAW75460.1 | 394 | GNAS complex locus, isoform CRA_d [Homo sapiens] |
GI:117938765 | GenBank | ABP12379.1 | 380 | Sequence 307 from patent US 7183105 |
GI:18426900 | GenBank | ACE86834.1 | 380 | GNAS complex locus protein, partial [synthetic construct] |
GI:4504047 | GenBank | ADP20528.2 | 394 | stimulatory G-protein alpha subunit [Heterocephalus glaber] |
GI:18426900 | PDB | 3SN6 | 380 | Chain A, Crystal Structure Of The Beta2 Adrenergic Receptor-Gs Protein Complex |
GI:18426900 | RefSeq | NP_001070978.1 | 380 | protein GNAS isoform GNASS [Mus musculus] |
GI:4504047 | RefSeq | NP_963910.1 | 394 | protein GNAS isoform GNASL [Mus musculus] |
GI:117938759 | RefSeq | XP_001083687.2 | 1046 | PREDICTED: guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas isoform 5 [Macaca mulatta] |
GI:117938759 | RefSeq | XP_002830517.1 | 1046 | PREDICTED: guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas isoform X3 [Pongo abelii] |
GI:117938768 | RefSeq | XP_003277552.1 | 648 | PREDICTED: protein ALEX-like [Nomascus leucogenys] |
GI:117938768 | RefSeq | XP_004014810.1 | 765 | PREDICTED: protein ALEX-like [Ovis aries] |
GI:117938762 | RefSeq | XP_005362840.1 | 395 | PREDICTED: guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas-like isoform X4 [Microtus ochrogaster] |
GI:117938762 | RefSeq | XP_005362841.1 | 395 | PREDICTED: guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas-like isoform X5 [Microtus ochrogaster] |
GI:117938765 | RefSeq | XP_005362845.1 | 379 | PREDICTED: guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas-like isoform X9 [Microtus ochrogaster] |
GI:117938768 | RefSeq | XP_005327149.1 | 650 | PREDICTED: guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas isoform X5 [Ictidomys tridecemlineatus] |
GI:117938768 | RefSeq | XP_005569514.1 | 647 | PREDICTED: guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas isoform X7 [Macaca fascicularis] |
GI:117938762 | RefSeq | XP_006498837.1 | 395 | PREDICTED: protein ALEX isoform X1 [Mus musculus] |
GI:117938765 | RefSeq | XP_006498839.1 | 379 | PREDICTED: protein ALEX isoform X3 [Mus musculus] |
GI:7706589 | RefSeq | XP_008010964.1 | 251 | PREDICTED: neuroendocrine secretory protein 55 [Chlorocebus sabaeus] |
GI:117938762 | RefSeq | XP_008139443.1 | 395 | PREDICTED: guanine nucleotide-binding protein G(s) subunit alpha isoforms short isoform X4 [Eptesicus fuscus] |
GI:18426900 | RefSeq | XP_008139445.1 | 380 | PREDICTED: guanine nucleotide-binding protein G(s) subunit alpha isoforms short isoform X6 [Eptesicus fuscus] |
GI:117938765 | RefSeq | XP_008139446.1 | 379 | PREDICTED: guanine nucleotide-binding protein G(s) subunit alpha isoform X7 [Eptesicus fuscus] |
GI:117938768 | RefSeq | XP_008949196.1 | 632 | PREDICTED: protein ALEX [Pan paniscus] |
GI:7706589 | RefSeq | XP_009214119.1 | 245 | PREDICTED: neuroendocrine secretory protein 55 [Papio anubis] |
GI:7706589 | RefSeq | XP_009214120.1 | 245 | PREDICTED: neuroendocrine secretory protein 55 [Papio anubis] |
GI:117938759 | RefSeq | XP_009435753.1 | 1059 | PREDICTED: guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas isoform X1 [Pan troglodytes] |
GI:117938759 | RefSeq | XP_009435754.1 | 1058 | PREDICTED: guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas isoform X2 [Pan troglodytes] |
GI:117938759 | RefSeq | XP_009435755.1 | 1044 | PREDICTED: guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas isoform X3 [Pan troglodytes] |
GI:117938759 | RefSeq | XP_009435756.1 | 1043 | PREDICTED: guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas isoform X4 [Pan troglodytes] |
GI:7706589 | RefSeq | XP_010363456.1 | 251 | PREDICTED: neuroendocrine secretory protein 55 [Rhinopithecus roxellana] |