Gene/Proteome Database (LMPD)
LMPD ID
LMP006648
Gene ID
Species
Homo sapiens (Human)
Gene Name
isopentenyl-diphosphate delta isomerase 1
Gene Symbol
Synonyms
IPP1; IPPI1
Alternate Names
isopentenyl-diphosphate Delta-isomerase 1; IPP isomerase 1; isopentenyl pyrophosphate isomerase 1; isopentenyl diphosphate dimethylallyl diphosphate isomerase 1
Chromosome
10
Map Location
10p15.3
EC Number
5.3.3.2
Summary
IDI1 encodes a peroxisomally-localized enzyme that catalyzes the interconversion of isopentenyl diphosphate (IPP) to its highly electrophilic isomer, dimethylallyl diphosphate (DMAPP), which are the substrates for the successive reaction that results in the synthesis of farnesyl diphosphate and, ultimately, cholesterol. It has been shown in peroxisomal deficiency diseases such as Zellweger syndrome and neonatal adrenoleukodystrophy that there is reduction in IPP isomerase activity. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
| isopentenyl-diphosphate Delta-isomerase 1 | |
|---|---|
| Refseq ID | NP_004499 |
| Protein GI | 40018633 |
| UniProt ID | Q13907 |
| mRNA ID | NM_004508 |
| Length | 284 |
| RefSeq Status | VALIDATED |
| MWRGLALARAIGCAARGRGQWAVRAADCAQSGRHPGPAVVCGRRLISVLEQIRHFVMMPEINTNHLDKQQVQLLAEMCILIDENDNKIGAETKKNCHLNENIEKGLLHRAFSVFLFNTENKLLLQQRSDAKITFPGCFTNTCCSHPLSNPAELEESDALGVRRAAQRRLKAELGIPLEEVPPEEINYLTRIHYKAQSDGIWGEHEIDYILLVRKNVTLNPDPNEIKSYCYVSKEELKELLKKAASGEIKITPWFKIIAATFLFKWWDNLNHLNQFVDHEKIYRM | |
Gene Information
Entrez Gene ID
Gene Name
isopentenyl-diphosphate delta isomerase 1
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005829 | TAS:Reactome | C | cytosol |
| GO:0005739 | IEA:Ensembl | C | mitochondrion |
| GO:0005777 | IDA:UniProtKB | C | peroxisome |
| GO:0016787 | IEA:InterPro | F | hydrolase activity |
| GO:0004452 | IDA:UniProtKB | F | isopentenyl-diphosphate delta-isomerase activity |
| GO:0000287 | IDA:UniProtKB | F | magnesium ion binding |
| GO:0030145 | IDA:UniProtKB | F | manganese ion binding |
| GO:0046872 | IEA:UniProtKB-KW | F | metal ion binding |
| GO:0006695 | TAS:Reactome | P | cholesterol biosynthetic process |
| GO:0050992 | IEA:UniProtKB-UniPathway | P | dimethylallyl diphosphate biosynthetic process |
| GO:0008299 | IDA:UniProtKB | P | isoprenoid biosynthetic process |
| GO:0035634 | IEA:Ensembl | P | response to stilbenoid |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| hsa00900 | Terpenoid backbone biosynthesis |
Domain Information
UniProt Annotations
Entry Information
Gene Name
isopentenyl-diphosphate delta isomerase 1
Protein Entry
IDI1_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q13907-1; Sequence=Displayed; Name=2; IsoId=Q13907-2; Sequence=VSP_037889; Note=Ref.8 (AAI07894) sequence is in conflict in position: 39:V->G. ; |
| Catalytic Activity | Isopentenyl diphosphate = dimethylallyl diphosphate. |
| Cofactor | Name=Mg(2+); Xref=ChEBI |
| Function | Catalyzes the 1,3-allylic rearrangement of the homoallylic substrate isopentenyl (IPP) to its highly electrophilic allylic isomer, dimethylallyl diphosphate (DMAPP). |
| Pathway | Isoprenoid biosynthesis; dimethylallyl diphosphate biosynthesis; dimethylallyl diphosphate from isopentenyl diphosphate: step 1/1. |
| Sequence Caution | Sequence=AAH57827.1; Type=Erroneous initiation; Evidence= ; Sequence=AAK29357.1; Type=Erroneous initiation; Evidence= ; Sequence=AAK49434.1; Type=Erroneous initiation; Evidence= ; Sequence=AAK49435.1; Type=Erroneous initiation; Evidence= ; Sequence=AAP35407.1; Type=Erroneous initiation; Evidence= ; Sequence=CAA34890.1; Type=Erroneous initiation; Evidence= ; |
| Similarity | Belongs to the IPP isomerase type 1 family. |
| Similarity | Contains 1 nudix hydrolase domain. |
| Subcellular Location | Peroxisome. |
| Subunit | Monomer. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006648 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 40018633 | RefSeq | NP_004499 | 284 | isopentenyl-diphosphate Delta-isomerase 1 |
Identical Sequences to LMP006648 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:40018633 | DBBJ | BAG64667.1 | 284 | unnamed protein product [Homo sapiens] |
| GI:40018633 | GenBank | EAW86521.1 | 284 | isopentenyl-diphosphate delta isomerase 1, isoform CRA_b [Homo sapiens] |
| GI:40018633 | GenBank | AHD74037.1 | 284 | Sequence 12957 from patent US 8586006 |
Related Sequences to LMP006648 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:40018633 | GenBank | JAA01770.1 | 284 | isopentenyl-diphosphate delta isomerase 1 [Pan troglodytes] |
| GI:40018633 | GenBank | JAA13063.1 | 284 | isopentenyl-diphosphate delta isomerase 1 [Pan troglodytes] |
| GI:40018633 | GenBank | JAA27589.1 | 284 | isopentenyl-diphosphate delta isomerase 1 [Pan troglodytes] |
| GI:40018633 | GenBank | JAA41713.1 | 284 | isopentenyl-diphosphate delta isomerase 1 [Pan troglodytes] |
| GI:40018633 | RefSeq | XP_003827812.1 | 284 | PREDICTED: isopentenyl-diphosphate Delta-isomerase 1 [Pan paniscus] |
| GI:40018633 | RefSeq | XP_003312477.2 | 437 | PREDICTED: isopentenyl-diphosphate Delta-isomerase 1 [Pan troglodytes] |