Gene/Proteome Database (LMPD)
Proteins
| phytanoyl-CoA dioxygenase domain-containing protein 1 isoform a | |
|---|---|
| Refseq ID | NP_001094346 |
| Protein GI | 154937350 |
| UniProt ID | Q5SRE7 |
| mRNA ID | NM_001100876 |
| Length | 291 |
| RefSeq Status | VALIDATED |
| MACLSPSQLQKFQQDGFLVLEGFLSAEECVAMQQRIGEIVAEMDVPLHCRTEFSTQEEEQLRAQGSTDYFLSSGDKIRFFFEKGVFDEKGNFLVPPEKSINKIGHALHAHDPVFKSITHSFKVQTLARSLGLQMPVVVQSMYIFKQPHFGGEVSPHQDASFLYTEPLGRVLGVWIAVEDATLENGCLWFIPGSHTSGVSRRMVRAPVGSAPGTSFLGSEPARDNSLFVPTPVQRGALVLIHGEVVHKSKQNLSDRSRQAYTFHLMEASGTTWSPENWLQPTAELPFPQLYT | |
| phytanoyl-CoA dioxygenase domain-containing protein 1 isoform b | |
|---|---|
| Refseq ID | NP_777593 |
| Protein GI | 154937348 |
| UniProt ID | Q5SRE7 |
| mRNA ID | NM_174933 |
| Length | 297 |
| RefSeq Status | VALIDATED |
| MACLSPSQLQKFQQDGFLVLEGFLSAEECVAMQQRIGEIVAEMDVPLHCRTEFSTQEEEQLRAQGSTDYFLSSGDKIRFFFEKGVFDEKGNFLVPPEKSINKIGHALHAHDPVFKSITHSFKVQTLARSLGLQMPVVVQSMYIFKSPLIRTPPSCTRSPWAGCWACGSQWRMPRWRTAVSGSSLAPTPVVCQEGWSGPLLAQRLVPASLGQSQPGITASLCPPQCREGPWSSSMEKWYTRASRTSLTARARPTLSTSWRPLAPPGARRTGSSQQLNCPFPNCTPKGSRRAGALAPPG | |
| phytanoyl-CoA dioxygenase domain-containing protein 1 isoform c | |
|---|---|
| Refseq ID | NP_001094347 |
| Protein GI | 154937352 |
| UniProt ID | Q5SRE7 |
| mRNA ID | NM_001100877 |
| Length | 270 |
| RefSeq Status | VALIDATED |
| MACLSPSQLQKFQQDGFLVLEGFLSAEECVAMQQRIGEIVAEMDVPLHCRTEFSTQEEEQLRAQGSTDYFLSSGDKIRFFFEKGVFDEKGNFLVPPEKSINKIGHALHAHDPVFKSITHSFKVQQPHFGGEVSPHQDASFLYTEPLGRVLGVWIAVEDATLENGCLWFIPGSHTSGVSRRMVRAPVGSAPGTSFLGSEPARDNSLFVPTPVQRGALVLIHGEVVHKSKQNLSDRSRQAYTFHLMEASGTTWSPENWLQPTAELPFPQLYT | |
Gene Information
Entrez Gene ID
Gene Name
phytanoyl-CoA dioxygenase domain containing 1
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0051213 | IEA:UniProtKB-KW | F | dioxygenase activity |
| GO:0046872 | IEA:UniProtKB-KW | F | metal ion binding |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR008775 | Phytanoyl-CoA dioxygenase |
UniProt Annotations
Entry Information
Gene Name
phytanoyl-CoA dioxygenase domain containing 1
Protein Entry
PHYD1_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=3; Name=1; Synonyms=A, PHYHD1A; IsoId=Q5SRE7-1; Sequence=Displayed; Name=2; Synonyms=C, PHYHD1C; IsoId=Q5SRE7-2; Sequence=VSP_030077; Name=3; Synonyms=B, PHYHD1B; IsoId=Q5SRE7-3; Sequence=VSP_030078; Note=Ref.4 (AAH09373) sequence is in conflict in position: 193:E->G. ; |
| Cofactor | Name=Fe cation; Xref=ChEBI |
| Enzyme Regulation | Activity is increased by ascorbate. Inhibited by myristoyl-CoA. |
| Function | Isoform 1 has alpha-ketoglutarate-dependent dioxygenase activity. Does not show detectable activity towards fatty acid CoA thioesters. Is not expected to be active with phytanoyl CoA. Isoform 2 and isoform 3 probably lack enzyme activity. |
| Sequence Caution | Sequence=CAI10840.1; Type=Erroneous gene model prediction; Evidence= ; Sequence=CAO72146.1; Type=Erroneous gene model prediction; Evidence= ; Sequence=CAO72147.1; Type=Erroneous gene model prediction; Evidence= ; |
| Similarity | Belongs to the PhyH family. PHYHD1 subfamily. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006655 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 154937350 | RefSeq | NP_001094346 | 291 | phytanoyl-CoA dioxygenase domain-containing protein 1 isoform a |
| 154937348 | RefSeq | NP_777593 | 297 | phytanoyl-CoA dioxygenase domain-containing protein 1 isoform b |
| 154937352 | RefSeq | NP_001094347 | 270 | phytanoyl-CoA dioxygenase domain-containing protein 1 isoform c |
Identical Sequences to LMP006655 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:154937350 | DBBJ | BAG52969.1 | 291 | unnamed protein product [Homo sapiens] |
| GI:154937352 | GenBank | AAH51300.1 | 270 | PHYHD1 protein [Homo sapiens] |
| GI:154937348 | GenBank | EAW87845.1 | 297 | phytanoyl-CoA dioxygenase domain containing 1, isoform CRA_b [Homo sapiens] |
| GI:154937352 | GenBank | EAW87847.1 | 270 | phytanoyl-CoA dioxygenase domain containing 1, isoform CRA_d [Homo sapiens] |
| GI:154937348 | GenBank | EAW87848.1 | 297 | phytanoyl-CoA dioxygenase domain containing 1, isoform CRA_b [Homo sapiens] |
| GI:154937350 | GenBank | ABP27896.1 | 291 | Sequence 2911 from patent US 7193069 |
| GI:154937350 | GenBank | ADQ32553.1 | 291 | phytanoyl-CoA dioxygenase domain containing 1, partial [synthetic construct] |
| GI:154937350 | GenBank | AIC58038.1 | 291 | PHYHD1, partial [synthetic construct] |
| GI:154937350 | PDB | 3OBZ | 291 | Chain A, Crystal Structure Of Human Phytanoyl-Coa Dioxygenase Phyhd1 2- Oxoglutarate And Iron Complex |
| GI:154937350 | SwissProt | Q5SRE7.2 | 291 | RecName: Full=Phytanoyl-CoA dioxygenase domain-containing protein 1 [Homo sapiens] |
Related Sequences to LMP006655 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:154937348 | GenBank | AAH09373.1 | 297 | Phytanoyl-CoA dioxygenase domain containing 1 [Homo sapiens] |
| GI:154937352 | GenBank | AAH53853.1 | 291 | PHYHD1 protein [Homo sapiens] |
| GI:154937352 | GenBank | ABP27896.1 | 291 | Sequence 2911 from patent US 7193069 |
| GI:154937352 | GenBank | ADQ32553.1 | 291 | phytanoyl-CoA dioxygenase domain containing 1, partial [synthetic construct] |
| GI:154937350 | GenBank | AFE77556.1 | 291 | phytanoyl-CoA dioxygenase domain-containing protein 1 isoform a [Macaca mulatta] |
| GI:154937348 | GenBank | JAA40955.1 | 297 | phytanoyl-CoA dioxygenase domain containing 1 [Pan troglodytes] |
| GI:154937352 | PDB | 2OPW | 291 | Chain A, Crystal Structure Of Human Phytanoyl-Coa Dioxygenase Phyhd1 (Apo) |
| GI:154937352 | PDB | 3OBZ | 291 | Chain A, Crystal Structure Of Human Phytanoyl-Coa Dioxygenase Phyhd1 2- Oxoglutarate And Iron Complex |
| GI:154937350 | RefSeq | XP_001162007.1 | 291 | PREDICTED: phytanoyl-CoA dioxygenase domain-containing protein 1 isoform X2 [Pan troglodytes] |
| GI:154937350 | RefSeq | XP_003822397.1 | 291 | PREDICTED: phytanoyl-CoA dioxygenase domain-containing protein 1 isoform X2 [Pan paniscus] |
| GI:154937350 | RefSeq | XP_004048756.1 | 291 | PREDICTED: phytanoyl-CoA dioxygenase domain-containing protein 1 isoform 1 [Gorilla gorilla gorilla] |
| GI:154937350 | RefSeq | XP_008004208.1 | 291 | PREDICTED: phytanoyl-CoA dioxygenase domain-containing protein 1 isoform X2 [Chlorocebus sabaeus] |
| GI:154937348 | RefSeq | XP_008974146.1 | 297 | PREDICTED: phytanoyl-CoA dioxygenase domain-containing protein 1 isoform X1 [Pan paniscus] |
| GI:154937348 | RefSeq | XP_008974148.1 | 297 | PREDICTED: phytanoyl-CoA dioxygenase domain-containing protein 1 isoform X1 [Pan paniscus] |
| GI:154937350 | RefSeq | XP_009243205.1 | 291 | PREDICTED: phytanoyl-CoA dioxygenase domain-containing protein 1 isoform X6 [Pongo abelii] |
| GI:154937348 | RefSeq | XP_009455719.1 | 297 | PREDICTED: phytanoyl-CoA dioxygenase domain-containing protein 1 isoform X1 [Pan troglodytes] |
| GI:154937348 | RefSeq | XP_009455720.1 | 297 | PREDICTED: phytanoyl-CoA dioxygenase domain-containing protein 1 isoform X1 [Pan troglodytes] |
| GI:154937352 | RefSeq | XP_009455722.1 | 270 | PREDICTED: phytanoyl-CoA dioxygenase domain-containing protein 1 isoform X4 [Pan troglodytes] |