Gene/Proteome Database (LMPD)
LMPD ID
LMP006676
Gene ID
Species
Homo sapiens (Human)
Gene Name
androgen receptor
Gene Symbol
Synonyms
AIS; DHTR; HUMARA; HYSP1; KD; NR3C4; SBMA; SMAX1; TFM
Chromosome
X
Map Location
Xq12
Summary
The androgen receptor gene is more than 90 kb long and codes for a protein that has 3 major functional domains: the N-terminal domain, DNA-binding domain, and androgen-binding domain. The protein functions as a steroid-hormone activated transcription factor. Upon binding the hormone ligand, the receptor dissociates from accessory proteins, translocates into the nucleus, dimerizes, and then stimulates transcription of androgen responsive genes. This gene contains 2 polymorphic trinucleotide repeat segments that encode polyglutamine and polyglycine tracts in the N-terminal transactivation domain of its protein. Expansion of the polyglutamine tract causes spinal bulbar muscular atrophy (Kennedy disease). Mutations in this gene are also associated with complete androgen insensitivity (CAIS). Two alternatively spliced variants encoding distinct isoforms have been described. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
androgen receptor isoform 1 | |
---|---|
Refseq ID | NP_000035 |
Protein GI | 21322252 |
UniProt ID | P10275 |
mRNA ID | NM_000044 |
Length | 920 |
RefSeq Status | REVIEWED |
MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREVIQNPGPRHPEAASAAPPGASLLLLQQQQQQQQQQQQQQQQQQQQQQQETSPRQQQQQQGEDGSPQAHRRGPTGYLVLDEEQQPSQPQSALECHPERGCVPEPGAAVAASKGLPQQLPAPPDEDDSAAPSTLSLLGPTFPGLSSCSADLKDILSEASTMQLLQQQQQEAVSEGSSSGRAREASGAPTSSKDNYLGGTSTISDNAKELCKAVSVSMGLGVEALEHLSPGEQLRGDCMYAPLLGVPPAVRPTPCAPLAECKGSLLDDSAGKSTEDTAEYSPFKGGYTKGLEGESLGCSGSAAAGSSGTLELPSTLSLYKSGALDEAAAYQSRDYYNFPLALAGPPPPPPPPHPHARIKLENPLDYGSAWAAAAAQCRYGDLASLHGAGAAGPGSGSPSAAASSSWHTLFTAEEGQLYGPCGGGGGGGGGGGGGGGGGGGGGGGEAGAVAPYGYTRPPQGLAGQESDFTAPDVWYPGGMVSRVPYPSPTCVKSEMGPWMDSYSGPYGDMRLETARDHVLPIDYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTQ |
androgen receptor isoform 2 | |
---|---|
Refseq ID | NP_001011645 |
Protein GI | 58535455 |
UniProt ID | P10275 |
mRNA ID | NM_001011645 |
Length | 388 |
RefSeq Status | REVIEWED |
MILWLHSLETARDHVLPIDYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTQ |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005737 | IDA:UniProtKB | C | cytoplasm |
GO:0000790 | IDA:BHF-UCL | C | nuclear chromatin |
GO:0005654 | TAS:Reactome | C | nucleoplasm |
GO:0005634 | IDA:UniProtKB | C | nucleus |
GO:0043234 | IDA:MGI | C | protein complex |
GO:0005497 | NAS:UniProtKB | F | androgen binding |
GO:0004882 | IDA:UniProtKB | F | androgen receptor activity |
GO:0008013 | IDA:BHF-UCL | F | beta-catenin binding |
GO:0003682 | IDA:UniProtKB | F | chromatin binding |
GO:0003677 | NAS:UniProtKB | F | DNA binding |
GO:0019899 | IPI:UniProtKB | F | enzyme binding |
GO:0004879 | IDA:BHF-UCL | F | ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity |
GO:0046983 | NAS:UniProtKB | F | protein dimerization activity |
GO:0005102 | IPI:UniProtKB | F | receptor binding |
GO:0000978 | IDA:NTNU_SB | F | RNA polymerase II core promoter proximal region sequence-specific DNA binding |
GO:0001077 | IDA:NTNU_SB | F | RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription |
GO:0001085 | IPI:BHF-UCL | F | RNA polymerase II transcription factor binding |
GO:0003700 | IDA:UniProtKB | F | sequence-specific DNA binding transcription factor activity |
GO:0008134 | IPI:BHF-UCL | F | transcription factor binding |
GO:0044212 | IDA:UniProtKB | F | transcription regulatory region DNA binding |
GO:0008270 | IEA:InterPro | F | zinc ion binding |
GO:0030521 | IDA:UniProtKB | P | androgen receptor signaling pathway |
GO:0007267 | TAS:ProtInc | P | cell-cell signaling |
GO:0008219 | IEA:UniProtKB-KW | P | cell death |
GO:0016049 | NAS:UniProtKB | P | cell growth |
GO:0008283 | NAS:UniProtKB | P | cell proliferation |
GO:0010467 | TAS:Reactome | P | gene expression |
GO:0030522 | IDA:BHF-UCL | P | intracellular receptor signaling pathway |
GO:2001237 | IDA:BHF-UCL | P | negative regulation of extrinsic apoptotic signaling pathway |
GO:0045720 | IDA:BHF-UCL | P | negative regulation of integrin biosynthetic process |
GO:0008284 | IDA:BHF-UCL | P | positive regulation of cell proliferation |
GO:0045726 | IDA:BHF-UCL | P | positive regulation of integrin biosynthetic process |
GO:0051092 | IMP:BHF-UCL | P | positive regulation of NF-kappaB transcription factor activity |
GO:0042327 | IMP:BHF-UCL | P | positive regulation of phosphorylation |
GO:0045893 | IDA:UniProtKB | P | positive regulation of transcription, DNA-templated |
GO:0045945 | IDA:BHF-UCL | P | positive regulation of transcription from RNA polymerase III promoter |
GO:0045944 | IDA:UniProtKB | P | positive regulation of transcription from RNA polymerase II promoter |
GO:0030850 | NAS:UniProtKB | P | prostate gland development |
GO:0051259 | IDA:MGI | P | protein oligomerization |
GO:0090003 | IDA:BHF-UCL | P | regulation of establishment of protein localization to plasma membrane |
GO:0007548 | NAS:UniProtKB | P | sex differentiation |
GO:0007165 | TAS:ProtInc | P | signal transduction |
GO:0006351 | IDA:UniProtKB | P | transcription, DNA-templated |
GO:0006367 | TAS:Reactome | P | transcription initiation from RNA polymerase II promoter |
GO:0006810 | TAS:ProtInc | P | transport |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
hsa04114 | Oocyte meiosis |
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; Synonyms=AR-B; IsoId=P10275-1; Sequence=Displayed; Name=2; Synonyms=AR-A, Variant AR45; IsoId=P10275-2; Sequence=VSP_036889, VSP_036890; |
Disease | Androgen insensitivity, partial (PAIS) [MIM |
Disease | Androgen insensitivity syndrome (AIS) [MIM |
Disease | Note=Defects in AR may play a role in metastatic prostate cancer. The mutated receptor stimulates prostate growth and metastases development despite of androgen ablation. This treatment can reduce primary and metastatic lesions probably by inducing apoptosis of tumor cells when they express the wild-type receptor. |
Disease | Spinal and bulbar muscular atrophy X-linked 1 (SMAX1) [MIM |
Domain | Composed of three domains: a modulating N-terminal domain, a DNA-binding domain and a C-terminal ligand-binding domain. In the presence of bound steroid the ligand-binding domain interacts with the N-terminal modulating domain, and thereby activates AR transcription factor activity. Agonist binding is required for dimerization and binding to target DNA. The transcription factor activity of the complex formed by ligand-activated AR and DNA is modulated by interactions with coactivator and corepressor proteins. Interaction with RANBP9 is mediated by both the N- terminal domain and the DNA-binding domain. Interaction with EFCAB6/DJBP is mediated by the DNA-binding domain. |
Enzyme Regulation | AIM-100 (4-amino-5,6-biaryl-furo[2,3- d]pyrimidine) suppresses TNK2-mediated phosphorylation at Tyr-267. Inhibits the binding of the Tyr-267 phosphorylated form to androgen-responsive enhancers (AREs) and its transcriptional activity. |
Function | Steroid hormone receptors are ligand-activated transcription factors that regulate eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Transcription factor activity is modulated by bound coactivator and corepressor proteins. Transcription activation is down-regulated by NR0B2. Activated, but not phosphorylated, by HIPK3 and ZIPK/DAPK3. {ECO |
Interaction | P00519:ABL1; NbExp=2; IntAct=EBI-608057, EBI-375543; P51451:BLK; NbExp=3; IntAct=EBI-608057, EBI-2105445; Q8WV28:BLNK; NbExp=2; IntAct=EBI-608057, EBI-2623522; P78543:BTG2; NbExp=4; IntAct=EBI-608057, EBI-1047576; O89110:Casp8 (xeno); NbExp=2; IntAct=EBI-608057, EBI-851690; Q92793:CREBBP; NbExp=2; IntAct=EBI-608057, EBI-81215; O14595:CTDSP2; NbExp=3; IntAct=EBI-608057, EBI-2802973; P35222:CTNNB1; NbExp=8; IntAct=EBI-608057, EBI-491549; Q9UER7:DAXX; NbExp=5; IntAct=EBI-608057, EBI-77321; P20711:DDC; NbExp=2; IntAct=EBI-608057, EBI-1632155; P11308:ERG; NbExp=3; IntAct=EBI-608057, EBI-79704; P07332:FES; NbExp=3; IntAct=EBI-608057, EBI-1055635; P09769:FGR; NbExp=3; IntAct=EBI-608057, EBI-1383732; O75593:FOXH1; NbExp=3; IntAct=EBI-608057, EBI-1759806; Q9R1E0:Foxo1 (xeno); NbExp=4; IntAct=EBI-608057, EBI-1371343; Q14451:GRB7; NbExp=3; IntAct=EBI-608057, EBI-970191; P56524:HDAC4; NbExp=4; IntAct=EBI-608057, EBI-308629; Q16665:HIF1A; NbExp=2; IntAct=EBI-608057, EBI-447269; Q16666:IFI16; NbExp=3; IntAct=EBI-608057, EBI-2867186; O15357:INPPL1; NbExp=3; IntAct=EBI-608057, EBI-1384248; Q15652:JMJD1C; NbExp=2; IntAct=EBI-608057, EBI-1224969; O95251:KAT7; NbExp=5; IntAct=EBI-608057, EBI-473199; P07288:KLK3; NbExp=3; IntAct=EBI-608057, EBI-1220791; P06239:LCK; NbExp=7; IntAct=EBI-608057, EBI-1348; P07948:LYN; NbExp=5; IntAct=EBI-608057, EBI-79452; P20794:MAK; NbExp=5; IntAct=EBI-608057, EBI-3911321; P42679:MATK; NbExp=4; IntAct=EBI-608057, EBI-751664; Q00987:MDM2; NbExp=2; IntAct=EBI-608057, EBI-389668; Q15596:NCOA2; NbExp=2; IntAct=EBI-608057, EBI-81236; Q14686:NCOA6; NbExp=2; IntAct=EBI-608057, EBI-78670; Q99497:PARK7; NbExp=6; IntAct=EBI-608057, EBI-1164361; P27986:PIK3R1; NbExp=5; IntAct=EBI-608057, EBI-79464; O00459:PIK3R2; NbExp=14; IntAct=EBI-608057, EBI-346930; Q92569:PIK3R3; NbExp=37; IntAct=EBI-608057, EBI-79893; P19174:PLCG1; NbExp=22; IntAct=EBI-608057, EBI-79387; P16885:PLCG2; NbExp=6; IntAct=EBI-608057, EBI-617403; Q06830:PRDX1; NbExp=3; IntAct=EBI-608057, EBI-353193; Q06124:PTPN11; NbExp=12; IntAct=EBI-608057, EBI-297779; P20936:RASA1; NbExp=16; IntAct=EBI-608057, EBI-1026476; Q9UBS8:RNF14; NbExp=2; IntAct=EBI-608057, EBI-2130308; Q9Y252:RNF6; NbExp=10; IntAct=EBI-608057, EBI-2341483; O14796:SH2D1B; NbExp=3; IntAct=EBI-608057, EBI-3923013; Q9NP31:SH2D2A; NbExp=6; IntAct=EBI-608057, EBI-490630; P29353:SHC1; NbExp=14; IntAct=EBI-608057, EBI-78835; Q6S5L8:SHC4; NbExp=3; IntAct=EBI-608057, EBI-9453524; Q5VZ18:SHE; NbExp=3; IntAct=EBI-608057, EBI-3956977; Q06986:Siah2 (xeno); NbExp=6; IntAct=EBI-608057, EBI-957413; Q15797:SMAD1; NbExp=6; IntAct=EBI-608057, EBI-1567153; O14544:SOCS6; NbExp=4; IntAct=EBI-608057, EBI-3929549; P12931:SRC; NbExp=7; IntAct=EBI-608057, EBI-621482; Q9ULZ2:STAP1; NbExp=2; IntAct=EBI-608057, EBI-6083058; P63165:SUMO1; NbExp=7; IntAct=EBI-608057, EBI-80140; Q9HBL0:TNS1; NbExp=3; IntAct=EBI-608057, EBI-3389814; O96028:WHSC1; NbExp=5; IntAct=EBI-608057, EBI-2693298; P07947:YES1; NbExp=5; IntAct=EBI-608057, EBI-515331; |
Miscellaneous | In the absence of ligand, steroid hormone receptors are thought to be weakly associated with nuclear components; hormone binding greatly increases receptor affinity. The hormone- receptor complex appears to recognize discrete DNA sequences upstream of transcriptional start sites. |
Miscellaneous | The level of tyrosine phosphorylation may serve as a diagnostic tool to predict patient outcome in response to hormone-ablation therapy. Inhibition of tyrosine phosphorylation may be an effective intervention target for hormone-refractory prostate cancer. |
Miscellaneous | Transcriptional activity is enhanced by binding to RANBP9. |
Polymorphism | The poly-Gln region of AR is highly polymorphic and the number of Gln varies in the population (from 17 to 26). A smaller size of the poly-Gln region may be associated with the development of prostate cancer. |
Polymorphism | The poly-Gly region of AR is polymorphic and ranges from 24 to 31 Gly. A poly-Gly region shorter or equal to 23 may be associated with the development of androgenetic alopecia. |
Ptm | Palmitoylated by ZDHHC7 and ZDHHC21. Palmitoylation is required for plasma membrane targeting and for rapid intracellular signaling via ERK and AKT kinases and cAMP generation. |
Ptm | Phosphorylated in prostate cancer cells in response to several growth factors including EGF. Phosphorylation is induced by c-Src kinase (CSK). Tyr-534 is one of the major phosphorylation sites and an increase in phosphorylation and Src kinase activity is associated with prostate cancer progression. Phosphorylation by TNK2 enhances the DNA-binding and transcriptional activity and may be responsible for androgen-independent progression of prostate cancer. Phosphorylation at Ser-81 by CDK9 regulates AR promoter selectivity and cell growth. Phosphorylation by PAK6 leads to AR- mediated transcription inhibition. {ECO |
Ptm | Sumoylated on Lys-386 (major) and Lys-520. Ubiquitinated. Deubiquitinated by USP26. 'Lys-6' and 'Lys-27'-linked polyubiquitination by RNF6 modulates AR transcriptional activity and specificity. {ECO |
Similarity | Belongs to the nuclear hormone receptor family. NR3 subfamily. |
Similarity | Contains 1 nuclear receptor DNA-binding domain. |
Subcellular Location | Nucleus. Cytoplasm. Note=Predominantly cytoplasmic in unligated form but translocates to the nucleus upon ligand-binding. Can also translocate to the nucleus in unligated form in the presence of GNB2L1. |
Subunit | Binds DNA as a homodimer. Part of a ternary complex containing AR, EFCAB6/DJBP and PARK7. Interacts with HIPK3 and NR0B2 in the presence of androgen. The ligand binding domain interacts with KAT7/HBO1 in the presence of dihydrotestosterone. Interacts with EFCAB6/DJBP, PELP1, PQBP1, RANBP9, RBAK, SPDEF, SRA1, TGFB1I1, ZNF318 and RREB1. Interacts with ZMIZ1/ZIMP10 and ZMIZ2/ZMIP7 which both enhance its transactivation activity. Interacts with SLC30A9 and RAD54L2/ARIP4. Interacts via the ligand-binding domain with LXXLL and FXXLF motifs from NCOA1, NCOA2, NCOA3, NCOA4 and MAGEA11. The AR N-terminal poly-Gln region binds Ran resulting in enhancement of AR-mediated transactivation. Ran-binding decreases as the poly-Gln length increases. Interacts with HIP1 (via coiled coil domain). Interacts (via ligand-binding domain) with TRIM68. Interacts with TNK2. Interacts with USP26. Interacts with RNF6. Interacts (regulated by RNF6 probably through polyubiquitination) with RNF14; regulates AR transcriptional activity. Interacts with PRMT2 and TRIM24. Interacts with GNB2L1/RACK1. Interacts with RANBP10; this interaction enhances dihydrotestosterone-induced AR transcriptional activity. Interacts with PRPF6 in a hormone-independent way; this interaction enhances dihydrotestosterone-induced AR transcriptional activity. Interacts with STK4/MST1. Interacts with ZIPK/DAPK3. Interacts with LPXN. Interacts with MAK. Part of a complex containing AR, MAK and NCOA3. Interacts with CRY1. {ECO |
Tissue Specificity | Isoform 2 is mainly expressed in heart and skeletal muscle. |
Web Resource | Name=Androgen receptor gene mutations database; URL="http://androgendb.mcgill.ca"; |
Web Resource | Name=Atlas of Genetics and Cytogenetics in Oncology and Haematology; URL="http://atlasgeneticsoncology.org/Genes/ARID685chXq12.html"; |
Web Resource | Name=Wikipedia; Note=Androgen receptor entry; URL="http://en.wikipedia.org/wiki/Androgen_receptor"; |
Web Resource | Name=X-chromosome gene database, androgen receptor (AR); Note=Leiden Open Variation Database (LOVD); URL="http://www.lovd.nl/AR"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP006676 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
21322252 | RefSeq | NP_000035 | 920 | androgen receptor isoform 1 |
58535455 | RefSeq | NP_001011645 | 388 | androgen receptor isoform 2 |
Identical Sequences to LMP006676 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:58535455 | EMBL | CAH89502.1 | 388 | hypothetical protein [Pongo abelii] |
GI:21322252 | EMBL | CCV20035.1 | 920 | unnamed protein product [Homo sapiens] |
GI:58535455 | GenBank | ADZ17334.1 | 388 | androgen nuclear receptor variant 2 [Homo sapiens] |
GI:21322252 | GenBank | AFD45320.1 | 920 | Sequence 28 from patent US 8129125 |
GI:21322252 | GenBank | AFL33673.1 | 920 | Sequence 55 from patent US 8173861 |
GI:21322252 | GenBank | AGN43277.1 | 920 | Sequence 83 from patent US 8450290 |
GI:21322252 | GenBank | AGV97421.1 | 920 | Sequence 2 from patent US 8513210 |
GI:21322252 | GenBank | AHD80469.1 | 920 | Sequence 32815 from patent US 8586006 |
GI:58535455 | GenBank | AHD80470.1 | 388 | Sequence 32816 from patent US 8586006 |
GI:58535455 | RefSeq | NP_001124649.1 | 388 | androgen receptor [Pongo abelii] |
Related Sequences to LMP006676 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:58535455 | EMBL | CAM97358.1 | 388 | androgen receptor [Macaca fascicularis] |
GI:21322252 | GenBank | ADB54358.1 | 920 | androgen receptor isoform 1 transcript variant 1 [Homo sapiens] |
GI:58535455 | GenBank | ADC18416.1 | 919 | Sequence 59 from patent US 7635753 |
GI:21322252 | GenBank | ADD26777.1 | 920 | androgen receptor isoform 1 transcript variant 1 [Homo sapiens] |
GI:21322252 | GenBank | ADD26778.1 | 920 | androgen receptor isoform 1 transcript variant 1 [Homo sapiens] |
GI:21322252 | GenBank | ADD26779.1 | 920 | androgen receptor isoform 1 transcript variant 1 [Homo sapiens] |
GI:21322252 | GenBank | ADD26780.1 | 920 | androgen receptor isoform 1 transcript variant 1 [Homo sapiens] |
GI:21322252 | GenBank | ADD26781.1 | 920 | androgen receptor isoform 1 transcript variant 1 [Homo sapiens] |
GI:58535455 | GenBank | ADH04800.1 | 388 | androgen receptor variant [Callithrix jacchus] |
GI:58535455 | RefSeq | XP_003272754.1 | 392 | PREDICTED: androgen receptor [Nomascus leucogenys] |
GI:58535455 | RefSeq | XP_008987670.1 | 388 | PREDICTED: androgen receptor isoform X2 [Callithrix jacchus] |
GI:58535455 | RefSeq | XP_010369130.1 | 392 | PREDICTED: androgen receptor [Rhinopithecus roxellana] |