Gene/Proteome Database (LMPD)
Proteins
| lipase maturation factor 2 | |
|---|---|
| Refseq ID | NP_149977 |
| Protein GI | 255918129 |
| UniProt ID | Q9BU23 |
| mRNA ID | NM_033200 |
| Length | 707 |
| RefSeq Status | VALIDATED |
| MAGSRLPRQLFLQGVAAVFMFAFASLYTQIPGLYGPEGILPARRTLRPQGKGRWQQLWETPTLLWEAPRLGLDTAQGLELLSLLGALVALGALLLSPLRHPVIYLLLWAAYLSACQVGQVFLYFQWDSLLLETGFLAVLVAPLRPASHRKEAPQGRQAGALPHEDLPFWLVRWLLFRLMFASGVVKLTSRCPAWWGLTALTYHYETQCLPTPAAWFAHHLPVWLHKLSVVATFLIEIAVPPLFFAPIRRLRLAAFYSQVLLQVLIIITGNYNFFNLMTLVLTTALLDDQHLAAEPGHGSRKKTATSWPKALLATLSLLLELAVYGLLAYGTVHYFGLEVDWQQRTIHSRTTFTFHQFSQWLKTLTLPTVWLGVASLVWELLSALWRWTQVRGWLRKLSAVVQLSLVGTATVALFLISLVPYSYVEPGTHGRLWTGAHRLFGAVEHLQLANSYGLFRRMTGLGGRPEVVLEGSYDGHHWTEIEFMYKPGNLSRPPPVVVPHQPRLDWQMWFAALGPHTHSPWFTSLVLRLLQGKEPVIRLVQSQVARYPFHKQPPTYVRAQRYKYWFSQPGEQGQWWRRQWVEEFFPSVSLGDPTLETLLRQFGLQEKSPPRTRSANSTLAQALHWTRSQLSPLEAPALLWGLLMAVGAVRFVQALLAPCSLRSSPLAPVSGEKRRPASQKDSGAASEQATAAPNPCSSSSRTTRRKK | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0016020 | IDA:UniProtKB | C | membrane |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR009613 | Lipase maturation factor |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q9BU23-1; Sequence=Displayed; Name=2; IsoId=Q9BU23-2; Sequence=VSP_032254; Name=3; IsoId=Q9BU23-3; Sequence=VSP_032255; Note=No experimental confirmation available.; |
| Function | Involved in the maturation of specific proteins in the endoplasmic reticulum. May be required for maturation and transport of active lipoprotein lipase (LPL) through the secretory pathway (By similarity). |
| Sequence Caution | Sequence=AAB03346.1; Type=Erroneous gene model prediction; Evidence= ; Sequence=BAC85437.1; Type=Miscellaneous discrepancy; Note=Chimeric cDNA.; Evidence= ; |
| Similarity | Belongs to the lipase maturation factor family. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO |
Identical and Related Proteins
Unique RefSeq proteins for LMP006696 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 255918129 | RefSeq | NP_149977 | 707 | lipase maturation factor 2 |
Identical Sequences to LMP006696 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:255918129 | DBBJ | BAJ17887.1 | 707 | lipase maturation factor 2, partial [synthetic construct] |
| GI:255918129 | EMBL | CAG30491.1 | 707 | Em:U62317.9 [Homo sapiens] |
| GI:255918129 | EMBL | CAK54517.1 | 707 | TMEM153 [synthetic construct] |
| GI:255918129 | EMBL | CAK54816.1 | 707 | TMEM153, partial [synthetic construct] |
| GI:255918129 | GenBank | AAH02942.2 | 707 | LMF2 protein [Homo sapiens] |
| GI:255918129 | SwissProt | Q9BU23.2 | 707 | RecName: Full=Lipase maturation factor 2; AltName: Full=Transmembrane protein 112B; AltName: Full=Transmembrane protein 153 [Homo sapiens] |
Related Sequences to LMP006696 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:255918129 | GenBank | EAW73550.1 | 707 | hypothetical protein BC002942, isoform CRA_c [Homo sapiens] |
| GI:255918129 | GenBank | JAA27736.1 | 707 | lipase maturation factor 2 [Pan troglodytes] |
| GI:255918129 | RefSeq | XP_003804627.1 | 707 | PREDICTED: lipase maturation factor 2 isoform X2 [Pan paniscus] |
| GI:255918129 | RefSeq | XP_003905805.1 | 707 | PREDICTED: lipase maturation factor 2 isoform X3 [Papio anubis] |
| GI:255918129 | RefSeq | XP_005566936.1 | 707 | PREDICTED: lipase maturation factor 2 isoform X1 [Macaca fascicularis] |
| GI:255918129 | RefSeq | XP_009436954.1 | 707 | PREDICTED: lipase maturation factor 2 [Pan troglodytes] |