Gene/Proteome Database (LMPD)

LMPD ID
LMP006697
Gene ID
142891
Species
Homo sapiens (Human)
Gene Name
sterile alpha motif domain containing 8
Gene Symbol
SAMD8
Synonyms
HEL-177; SMSr
Chromosome
10
Map Location
10q22.2
EC Number
2.7.8.-

Proteins

sphingomyelin synthase-related protein 1 isoform 1
Refseq ID NP_001167627
Protein GI 292658773
UniProt ID Q96LT4
mRNA ID NM_001174156
Length 415
RefSeq Status VALIDATED
MAGPNQLCIRRWTTKHVAVWLKDEGFFEYVDILCNKHRLDGITLLTLTEYDLRSPPLEIKVLGDIKRLMLSVRKLQKIHIDVLEEMGYNSDSPMGSMTPFISALQSTDWLCNGELSHDCDGPITDLNSDQYQYMNGKNKHSVRRLDPEYWKTILSCIYVFIVFGFTSFIMVIVHERVPDMQTYPPLPDIFLDSVPRIPWAFAMTEVCGMILCYIWLLVLLLHKHRSILLRRLCSLMGTVFLLRCFTMFVTSLSVPGQHLQCTGKIYGSVWEKLHRAFAIWSGFGMTLTGVHTCGDYMFSGHTVVLTMLNFFVTEYTPRSWNFLHTLSWVLNLFGIFFILAAHEHYSIDVFIAFYITTRLFLYYHTLANTRAYQQSRRARIWFPMFSFFECNVNGTVPNEYCWPFSKPAIMKRLIG
sphingomyelin synthase-related protein 1 isoform 2
Refseq ID NP_653261
Protein GI 21389545
UniProt ID Q96LT4
mRNA ID NM_144660
Length 326
RefSeq Status VALIDATED
MAGPNQLCIRRWTTKHVAVWLKDEGFFEYVDILCNKHRLDGITLLTLTEYDLRSPPLEIKVLGDIKRLMLSVRKLQKIHIDVLEEMGYNSDSPMGSMTPFISALQSTDWLCNGELSHDCDGPITDLNSDQYQYMNGKNKHSVRRLDPEYWKTILSCIYVFIVFGFTSFIMVIVHERVPDMQTYPPLPDIFLDSVPRIPWAFAMTEVCGMILCYIWLLVLLLHKHRSILLRRLCSLMGTVFLLRCFTMFVTSLSVPGQHLQCTGKIYGSVWEKLHRAFAIWSGFGMTLTGVHTCGDYMFSGHTVVLTMLNFFVTECKYLFSASMRIR

Gene Information

Entrez Gene ID
142891
Gene Name
sterile alpha motif domain containing 8
Gene Symbol
SAMD8
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0030176 IDA:UniProtKB C integral component of endoplasmic reticulum membrane
GO:0016021 NAS:UniProtKB C integral component of membrane
GO:0016740 IEA:UniProtKB-KW F transferase activity
GO:0046513 IDA:UniProtKB P ceramide biosynthetic process
GO:2000303 IDA:UniProtKB P regulation of ceramide biosynthetic process
GO:0006686 NAS:UniProtKB P sphingomyelin biosynthetic process

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY3DJ-11281 sphingomyelin metabolism

Domain Information

InterPro Annotations

Accession Description
IPR025749 Sphingomyelin synthase-like domain
IPR001660 Sterile alpha motif domain
IPR013761 Sterile alpha motif/pointed domain
IPR021129 Sterile alpha motif, type 1

UniProt Annotations

Entry Information

Gene Name
sterile alpha motif domain containing 8
Protein Entry
Q96LT4_HUMAN
UniProt ID
Q96LT4
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q96LT4-1; Sequence=Displayed; Name=2; IsoId=Q96LT4-2; Sequence=VSP_038403, VSP_038404;
Domain The SAM domain is required to retain SMAD8 in the endoplasmic reticulum.
Function Sphingomyelin synthases synthesize sphingolipids through transfer of a phosphatidyl head group on to the primary hydroxyl of ceramide. SAMD8 is an endoplasmic reticulum (ER) transferase that has no sphingomyelin synthase activity but can convert phosphatidylethanolamine (PE) and ceramide to ceramide phosphoethanolamine (CPE) albeit with low product yield. Appears to operate as a ceramide sensor to control ceramide homeostasis in the endoplasmic reticulum rather than a converter of ceramides. Seems to be critical for the integrity of the early secretory pathway.
Sequence Caution Sequence=AAH80593.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence= ;
Similarity Belongs to the sphingomyelin synthase family.
Similarity Contains 1 SAM (sterile alpha motif) domain.
Subcellular Location Endoplasmic reticulum membrane ; Multi-pass membrane protein .

Identical and Related Proteins

Unique RefSeq proteins for LMP006697 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
292658773 RefSeq NP_001167627 415 sphingomyelin synthase-related protein 1 isoform 1
21389545 RefSeq NP_653261 326 sphingomyelin synthase-related protein 1 isoform 2

Identical Sequences to LMP006697 proteins

Reference Database Accession Length Protein Name
GI:21389545 DBBJ BAJ17800.1 326 sterile alpha motif domain containing 8, partial [synthetic construct]
GI:21389545 GenBank EAW54568.1 326 sterile alpha motif domain containing 8, isoform CRA_c [Homo sapiens]
GI:21389545 GenBank AAI40220.1 326 Sterile alpha motif domain containing 8, partial [synthetic construct]
GI:21389545 GenBank AAI46557.1 326 Sterile alpha motif domain containing 8 [synthetic construct]
GI:21389545 GenBank ACF94485.1 326 epididymis luminal protein 177 [Homo sapiens]
GI:292658773 GenBank JAA38583.1 415 sterile alpha motif domain containing 8 [Pan troglodytes]
GI:292658773 GenBank JAA38584.1 415 sterile alpha motif domain containing 8 [Pan troglodytes]
GI:21389545 RefSeq XP_004049677.1 326 PREDICTED: sphingomyelin synthase-related protein 1 [Gorilla gorilla gorilla]
GI:292658773 RefSeq XP_005269598.1 415 PREDICTED: sphingomyelin synthase-related protein 1 isoform X2 [Homo sapiens]
GI:292658773 RefSeq XP_009457045.1 415 PREDICTED: sphingomyelin synthase-related protein 1 isoform X2 [Pan troglodytes]
GI:292658773 RefSeq XP_010348767.1 415 PREDICTED: sphingomyelin synthase-related protein 1 isoform X1 [Saimiri boliviensis boliviensis]
GI:292658773 RefSeq XP_010348768.1 415 PREDICTED: sphingomyelin synthase-related protein 1 isoform X1 [Saimiri boliviensis boliviensis]

Related Sequences to LMP006697 proteins

Reference Database Accession Length Protein Name
GI:292658773 GenBank AAH80593.1 449 SAMD8 protein, partial [Homo sapiens]
GI:21389545 GenBank EAW54565.1 389 sterile alpha motif domain containing 8, isoform CRA_a [Homo sapiens]
GI:292658773 GenBank EAW54566.1 478 sterile alpha motif domain containing 8, isoform CRA_b [Homo sapiens]
GI:21389545 RefSeq XP_001096809.2 389 PREDICTED: sphingomyelin synthase-related protein 1 isoform 2 [Macaca mulatta]
GI:21389545 RefSeq XP_003939828.1 326 PREDICTED: sphingomyelin synthase-related protein 1 isoform X2 [Saimiri boliviensis boliviensis]
GI:21389545 RefSeq XP_004426989.1 326 PREDICTED: sphingomyelin synthase-related protein 1 isoform 2 [Ceratotherium simum simum]
GI:21389545 RefSeq XP_007938777.1 344 PREDICTED: sphingomyelin synthase-related protein 1 isoform X1 [Orycteropus afer afer]
GI:21389545 RefSeq XP_008694304.1 326 PREDICTED: sphingomyelin synthase-related protein 1 isoform X2 [Ursus maritimus]
GI:292658773 RefSeq XP_008963806.1 415 PREDICTED: sphingomyelin synthase-related protein 1 [Pan paniscus]
GI:292658773 RefSeq XP_008963807.1 415 PREDICTED: sphingomyelin synthase-related protein 1 [Pan paniscus]
GI:292658773 RefSeq XP_008963808.1 415 PREDICTED: sphingomyelin synthase-related protein 1 [Pan paniscus]
GI:292658773 RefSeq XP_009457044.1 478 PREDICTED: sphingomyelin synthase-related protein 1 isoform X1 [Pan troglodytes]