Gene/Proteome Database (LMPD)
LMPD ID
LMP006713
Gene ID
Species
Homo sapiens (Human)
Gene Name
acyl-CoA wax alcohol acyltransferase 1
Gene Symbol
Synonyms
DGA2; DGAT2L3
Alternate Names
acyl-CoA wax alcohol acyltransferase 1; diacylglycerol acyltransferase 2; diacyl-glycerol acyltransferase 2; diacylglycerol O-acyltransferase 2-like 3; long-chain-alcohol O-fatty-acyltransferase 1; diacylglycerol O-acyltransferase 2-like protein 3
Chromosome
X
Map Location
Xq13.1
EC Number
2.3.1.75
Summary
The protein encoded by this gene belongs to the diacylglycerol acyltransferase family. It esterifies long chain (wax) alcohols with acyl-CoA-derived fatty acids to produce wax esters. Wax esters are enriched in sebum, suggesting that this enzyme plays a central role in lipid metabolism in skin. Consistent with this observation, this protein is predominantly expressed in the sebaceous gland of the skin. [provided by RefSeq, Sep 2009]
Orthologs
Proteins
| acyl-CoA wax alcohol acyltransferase 1 | |
|---|---|
| Refseq ID | NP_001013597 |
| Protein GI | 61888902 |
| UniProt ID | Q58HT5 |
| mRNA ID | NM_001013579 |
| Length | 328 |
| RefSeq Status | REVIEWED |
| MAHSKQPSHFQSLMLLQWPLSYLAIFWILQPLFVYLLFTSLWPLPVLYFAWLFLDWKTPERGGRRSAWVRNWCVWTHIRDYFPITILKTKDLSPEHNYLMGVHPHGLLTFGAFCNFCTEATGFSKTFPGITPHLATLSWFFKIPFVREYLMAKGVCSVSQPAINYLLSHGTGNLVGIVVGGVGEALQSVPNTTTLILQKRKGFVRTALQHGAHLVPTFTFGETEVYDQVLFHKDSRMYKFQSCFRRIFGFYCCVFYGQSFCQGSTGLLPYSRPIVTVVGEPLPLPQIEKPSQEMVDKYHALYMDALHKLFDQHKTHYGCSETQKLFFL | |
Gene Information
Entrez Gene ID
Gene Name
acyl-CoA wax alcohol acyltransferase 1
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0047196 | IEA:UniProtKB-EC | F | long-chain-alcohol O-fatty-acyltransferase activity |
| GO:0006629 | IEA:UniProtKB-KW | P | lipid metabolic process |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR007130 | Diacylglycerol acyltransferase |
UniProt Annotations
Entry Information
Gene Name
acyl-CoA wax alcohol acyltransferase 1
Protein Entry
AWAT1_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Biophysicochemical Properties | Kinetic parameters: Vmax=31.7 pmol/min/mg enzyme with [14C]oleoyl-CoA as substrate ; Vmax=113 pmol/min/mg enzyme with [14C]cetyl-CoA as substrate ; |
| Catalytic Activity | Acyl-CoA + a long-chain alcohol = CoA + a long-chain ester. |
| Function | Acyltransferase that predominantly esterify long chain (wax) alcohols with acyl-CoA-derived fatty acids to produce wax esters. Wax esters are enriched in sebum, suggesting that it plays a central role in lipid metabolism in skin. Has a preference for arachidyl alcohol as well as decyl alcohol, demonstrating its relatively poor activity using saturated long chain alcohols (C16, C18, and C20). |
| Similarity | Belongs to the diacylglycerol acyltransferase family. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO |
| Tissue Specificity | Predominantly expressed in skin, where it is limited to the sebaceous gland. Expressed in more mature, centrally located cells just before their rupture and sebum release. Also expressed in all tissues except spleen. Expressed at higher level in thymus, prostate and testis. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006713 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 61888902 | RefSeq | NP_001013597 | 328 | acyl-CoA wax alcohol acyltransferase 1 |
Identical Sequences to LMP006713 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:61888902 | DBBJ | BAI46284.1 | 328 | acyl-CoA wax alcohol acyltransferase 1, partial [synthetic construct] |
| GI:61888902 | GenBank | AAI46429.1 | 328 | Acyl-CoA wax alcohol acyltransferase 1, partial [synthetic construct] |
| GI:61888902 | GenBank | AAI53035.1 | 328 | Acyl-CoA wax alcohol acyltransferase 1 [synthetic construct] |
| GI:61888902 | GenBank | ADS49011.1 | 328 | Sequence 2 from patent US 7803593 |
| GI:61888902 | GenBank | AGN47197.1 | 328 | Sequence 2 from patent US 8343745 |
| GI:61888902 | SwissProt | Q58HT5.1 | 328 | RecName: Full=Acyl-CoA wax alcohol acyltransferase 1; AltName: Full=Diacylglycerol O-acyltransferase 2-like protein 3; AltName: Full=Diacylglycerol acyltransferase 2; AltName: Full=Long-chain-alcohol O-fatty-acyltransferase 1 [Homo sapiens] |
Related Sequences to LMP006713 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:61888902 | GenBank | EHH30818.1 | 328 | Acyl-CoA wax alcohol acyltransferase 1 [Macaca mulatta] |
| GI:61888902 | GenBank | EHH60962.1 | 328 | Acyl-CoA wax alcohol acyltransferase 1 [Macaca fascicularis] |
| GI:61888902 | RefSeq | XP_001083656.1 | 328 | PREDICTED: acyl-CoA wax alcohol acyltransferase 1 [Macaca mulatta] |
| GI:61888902 | RefSeq | XP_003820214.1 | 328 | PREDICTED: acyl-CoA wax alcohol acyltransferase 1 [Pan paniscus] |
| GI:61888902 | RefSeq | XP_005593905.1 | 328 | PREDICTED: acyl-CoA wax alcohol acyltransferase 1 isoform X1 [Macaca fascicularis] |
| GI:61888902 | RefSeq | XP_005593906.1 | 328 | PREDICTED: acyl-CoA wax alcohol acyltransferase 1 isoform X2 [Macaca fascicularis] |