Gene/Proteome Database (LMPD)

LMPD ID
LMP006718
Gene ID
Species
Homo sapiens (Human)
Gene Name
fatty acid binding protein 5 (psoriasis-associated)
Gene Symbol
Synonyms
E-FABP; EFABP; KFABP; PA-FABP; PAFABP
Chromosome
8
Map Location
8q21.13
Summary
This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs may play roles in fatty acid uptake, transport, and metabolism. Polymorphisms in this gene are associated with type 2 diabetes. The human genome contains many pseudogenes similar to this locus.[provided by RefSeq, Feb 2011]
Orthologs

Proteins

fatty acid-binding protein, epidermal
Refseq ID NP_001435
Protein GI 4557581
UniProt ID Q01469
mRNA ID NM_001444
Length 135
RefSeq Status REVIEWED
MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE

Gene Information

Entrez Gene ID
Gene Name
fatty acid binding protein 5 (psoriasis-associated)
Gene Symbol
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005504 IEA:Ensembl F fatty acid binding
GO:0005215 IEA:InterPro F transporter activity
GO:0006006 IEA:Ensembl P glucose metabolic process
GO:0015758 IEA:Ensembl P glucose transport
GO:0006656 IEA:Ensembl P phosphatidylcholine biosynthetic process
GO:0009611 IEA:Ensembl P response to wounding

KEGG Pathway Links

KEGG Pathway ID Description
hsa03320 PPAR signaling pathway
ko03320 PPAR signaling pathway

Domain Information

InterPro Annotations

Accession Description
IPR012674 Calycin
IPR011038 Calycin-like
IPR000463 Cytosolic fatty-acid binding
IPR000566 Lipocalin/cytosolic fatty-acid binding domain

UniProt Annotations

Entry Information

Gene Name
fatty acid binding protein 5 (psoriasis-associated)
Protein Entry
FABP5_HUMAN
UniProt ID
Species
Human

Identical and Related Proteins

Unique RefSeq proteins for LMP006718 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
4557581 RefSeq NP_001435 135 fatty acid-binding protein, epidermal

Identical Sequences to LMP006718 proteins

Reference Database Accession Length Protein Name
GI:4557581 GenBank AGA40472.1 135 Sequence 16 from patent US 8321143
GI:4557581 GenBank AGU04137.1 135 Sequence 28 from patent US 8476008
GI:4557581 GenBank AHD70815.1 135 Sequence 4283 from patent US 8586006
GI:4557581 GenBank AHD70969.1 135 Sequence 4437 from patent US 8586006
GI:4557581 GenBank AHD70971.1 135 Sequence 4439 from patent US 8586006
GI:4557581 RefSeq XP_009453824.1 135 PREDICTED: fatty acid-binding protein, epidermal [Pan troglodytes]

Related Sequences to LMP006718 proteins

Reference Database Accession Length Protein Name
GI:4557581 PDB 4AZM 138 Chain A, Human Epidermal Fatty Acid-binding Protein (fabp5) In Complex With The Inhibitor Bms-309413
GI:4557581 PDB 4AZM 138 Chain B, Human Epidermal Fatty Acid-binding Protein (fabp5) In Complex With The Inhibitor Bms-309413
GI:4557581 PDB 4LKT 138 Chain A, Crystal Structure Of Human Epidermal Fatty Acid Binding Protein (fabp5) In Complex With Linoleic Acid
GI:4557581 PDB 4LKT 138 Chain B, Crystal Structure Of Human Epidermal Fatty Acid Binding Protein (fabp5) In Complex With Linoleic Acid
GI:4557581 PDB 4LKT 138 Chain C, Crystal Structure Of Human Epidermal Fatty Acid Binding Protein (fabp5) In Complex With Linoleic Acid
GI:4557581 PDB 4LKT 138 Chain D, Crystal Structure Of Human Epidermal Fatty Acid Binding Protein (fabp5) In Complex With Linoleic Acid