Gene/Proteome Database (LMPD)
LMPD ID
LMP006720
Gene ID
Species
Homo sapiens (Human)
Gene Name
monoacylglycerol O-acyltransferase 3
Gene Symbol
Synonyms
DC7; DGAT2L7; MGAT3
Alternate Names
2-acylglycerol O-acyltransferase 3; acyl-CoA:monoacylglycerol acyltransferase 3; diacylglycerol O-acyltransferase candidate 7; diacylglycerol acyltransferase 2-like protein 7; acyl coenzyme A:monoacylglycerol acyltransferase 3
Chromosome
7
Map Location
7q22.1
EC Number
2.3.1.20
Summary
Acyl-CoA:monoacylglycerol acyltransferase (MOGAT; EC 2.3.1.22) catalyzes the synthesis of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA (Cheng et al., 2003 [PubMed 12618427]).[supplied by OMIM, Mar 2008]
Orthologs
Proteins
2-acylglycerol O-acyltransferase 3 isoform a | |
---|---|
Refseq ID | NP_835470 |
Protein GI | 30039700 |
UniProt ID | Q86VF5 |
mRNA ID | NM_178176 |
Length | 341 |
RefSeq Status | VALIDATED |
MGVATTLQPPTTSKTLQKQHLEAVGAYQYVLTFLFMGPFFSLLVFVLLFTSLWPFSVFYLVWLYVDWDTPNQGGRRSEWIRNRAIWRQLRDYYPVKLVKTAELPPDRNYVLGAHPHGIMCTGFLCNFSTESNGFSQLFPGLRPWLAVLAGLFYLPVYRDYIMSFGLCPVSRQSLDFILSQPQLGQAVVIMVGGAHEALYSVPGEHCLTLQKRKGFVRLALRHGASLVPVYSFGENDIFRLKAFATGSWQHWCQLTFKKLMGFSPCIFWGRGLFSATSWGLLPFAVPITTVVGRPIPVPQRLHPTEEEVNHYHALYMTALEQLFEEHKESCGVPASTCLTFI |
2-acylglycerol O-acyltransferase 3 isoform b | |
---|---|
Refseq ID | NP_001274076 |
Protein GI | 560592026 |
UniProt ID | Q86VF5 |
mRNA ID | NM_001287147 |
Length | 281 |
RefSeq Status | VALIDATED |
MGVATTLQPPTTSKTLQKQHLEAVGAYQYVLTFLFMGPFFSLLVFVLLFTSLWPFSVFYLVWLYVDWDTPNQGGRRSEWIRNRAIWRQLRDYYPVKLVKTAELPPDRNYVLGAHPHGIMCTGFLCNFSTESNGFSQLFPGLRPWLAVLAGLFYLPVYRDYIMSFGLCPVSRQSLDFILSQPQLGQAVVIMVGGAHEALYSVPGEHCLTLQKRKGFVRLALRHGGPPHPRPPAPPPHRGGSQSLSRPLHDGPGAALRGAQGKLWGPRFHLPHLHLGLAAAFR |
Gene Information
Entrez Gene ID
Gene Name
monoacylglycerol O-acyltransferase 3
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0003846 | IEA:UniProtKB-EC | F | 2-acylglycerol O-acyltransferase activity |
GO:0004144 | IEA:UniProtKB-EC | F | diacylglycerol O-acyltransferase activity |
GO:0006071 | IEA:UniProtKB-KW | P | glycerol metabolic process |
GO:0019432 | IEA:UniProtKB-UniPathway | P | triglyceride biosynthetic process |
KEGG Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR007130 | Diacylglycerol acyltransferase |
UniProt Annotations
Entry Information
Gene Name
monoacylglycerol O-acyltransferase 3
Protein Entry
MOGT3_HUMAN
UniProt ID
Species
Human
Comments
Comment Type | Description |
---|---|
Alternative Products | Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q86VF5-1; Sequence=Displayed; Name=2; IsoId=Q86VF5-2; Sequence=VSP_020361, VSP_020362; Note=No experimental confirmation available.; Name=3; IsoId=Q86VF5-3; Sequence=VSP_020363; Note=No experimental confirmation available.; |
Biophysicochemical Properties | Kinetic parameters: Vmax=9.3 nmol/min/mg enzyme with diacylglycerol as substrate ; Vmax=22.8 nmol/min/mg enzyme with 2-monoacylglycerol as substrate ; |
Catalytic Activity | Acyl-CoA + 1,2-diacylglycerol = CoA + triacylglycerol. |
Catalytic Activity | Acyl-CoA + 2-acylglycerol = CoA + diacylglycerol. |
Function | Catalyzes the formation of diacylglycerol from 2- monoacylglycerol and fatty acyl-CoA. Also able to catalyze the terminal step in triacylglycerol synthesis by using diacylglycerol and fatty acyl-CoA as substrates. Has a preference toward palmitoyl-CoA and oleoyl-CoA. May be involved in absorption of dietary fat in the small intestine by catalyzing the resynthesis of triacylglycerol in enterocytes. |
Pathway | Glycerolipid metabolism; triacylglycerol biosynthesis. |
Sequence Caution | Sequence=AAD45832.1; Type=Erroneous gene model prediction; Evidence= ; |
Similarity | Belongs to the diacylglycerol acyltransferase family. |
Subcellular Location | Endoplasmic reticulum membrane {ECO |
Tissue Specificity | Selectively expressed in the digestive system. Highly expressed in the ileum, and at lower level in jejunum, duodenum, colon, cecum and the rectum. Not expressed in the stomach and the esophagus and trachea. Expressed at very low level in liver. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006720 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
30039700 | RefSeq | NP_835470 | 341 | 2-acylglycerol O-acyltransferase 3 isoform a |
560592026 | RefSeq | NP_001274076 | 281 | 2-acylglycerol O-acyltransferase 3 isoform b |
Identical Sequences to LMP006720 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:30039700 | EMBL | CBU92414.1 | 341 | unnamed protein product [Homo sapiens] |
GI:560592026 | GenBank | AAI00956.1 | 281 | MOGAT3 protein [Homo sapiens] |
GI:30039700 | GenBank | AED72406.1 | 341 | Sequence 8 from patent US 7910346 |
GI:30039700 | GenBank | AGC98165.1 | 341 | Sequence 8 from patent US 8334111 |
GI:30039700 | GenBank | AGX59581.1 | 341 | Sequence 19441 from patent US 8541208 |
GI:30039700 | GenBank | AGX72246.1 | 341 | Sequence 44291 from patent US 8541208 |
GI:30039700 | GenBank | AHD69566.1 | 341 | Sequence 580 from patent US 8586006 |
Related Sequences to LMP006720 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:560592026 | EMBL | CBF90900.1 | 341 | unnamed protein product [Homo sapiens] |
GI:560592026 | EMBL | CBF67541.1 | 341 | unnamed protein product [Homo sapiens] |
GI:30039700 | GenBank | AAI00954.1 | 341 | Monoacylglycerol O-acyltransferase 3 [Homo sapiens] |
GI:560592026 | GenBank | ACR92671.1 | 341 | Sequence 8 from patent US 7527962 |
GI:30039700 | GenBank | EHH52051.1 | 341 | hypothetical protein EGM_12419 [Macaca fascicularis] |
GI:560592026 | GenBank | AGX59581.1 | 341 | Sequence 19441 from patent US 8541208 |
GI:560592026 | GenBank | AHD69566.1 | 341 | Sequence 580 from patent US 8586006 |
GI:30039700 | GenBank | AIC58191.1 | 341 | MOGAT3, partial [synthetic construct] |
GI:30039700 | RefSeq | XP_527842.3 | 341 | PREDICTED: 2-acylglycerol O-acyltransferase 3 isoform X2 [Pan troglodytes] |
GI:30039700 | RefSeq | XP_003807246.1 | 341 | PREDICTED: 2-acylglycerol O-acyltransferase 3 isoform X2 [Pan paniscus] |
GI:30039700 | RefSeq | XP_008016659.1 | 341 | PREDICTED: 2-acylglycerol O-acyltransferase 3 [Chlorocebus sabaeus] |
GI:560592026 | RefSeq | XP_008957496.1 | 281 | PREDICTED: 2-acylglycerol O-acyltransferase 3 isoform X3 [Pan paniscus] |