Gene/Proteome Database (LMPD)

LMPD ID
LMP006720
Gene ID
Species
Homo sapiens (Human)
Gene Name
monoacylglycerol O-acyltransferase 3
Gene Symbol
Synonyms
DC7; DGAT2L7; MGAT3
Alternate Names
2-acylglycerol O-acyltransferase 3; acyl-CoA:monoacylglycerol acyltransferase 3; diacylglycerol O-acyltransferase candidate 7; diacylglycerol acyltransferase 2-like protein 7; acyl coenzyme A:monoacylglycerol acyltransferase 3
Chromosome
7
Map Location
7q22.1
EC Number
2.3.1.20
Summary
Acyl-CoA:monoacylglycerol acyltransferase (MOGAT; EC 2.3.1.22) catalyzes the synthesis of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA (Cheng et al., 2003 [PubMed 12618427]).[supplied by OMIM, Mar 2008]
Orthologs

Proteins

2-acylglycerol O-acyltransferase 3 isoform a
Refseq ID NP_835470
Protein GI 30039700
UniProt ID Q86VF5
mRNA ID NM_178176
Length 341
RefSeq Status VALIDATED
MGVATTLQPPTTSKTLQKQHLEAVGAYQYVLTFLFMGPFFSLLVFVLLFTSLWPFSVFYLVWLYVDWDTPNQGGRRSEWIRNRAIWRQLRDYYPVKLVKTAELPPDRNYVLGAHPHGIMCTGFLCNFSTESNGFSQLFPGLRPWLAVLAGLFYLPVYRDYIMSFGLCPVSRQSLDFILSQPQLGQAVVIMVGGAHEALYSVPGEHCLTLQKRKGFVRLALRHGASLVPVYSFGENDIFRLKAFATGSWQHWCQLTFKKLMGFSPCIFWGRGLFSATSWGLLPFAVPITTVVGRPIPVPQRLHPTEEEVNHYHALYMTALEQLFEEHKESCGVPASTCLTFI
2-acylglycerol O-acyltransferase 3 isoform b
Refseq ID NP_001274076
Protein GI 560592026
UniProt ID Q86VF5
mRNA ID NM_001287147
Length 281
RefSeq Status VALIDATED
MGVATTLQPPTTSKTLQKQHLEAVGAYQYVLTFLFMGPFFSLLVFVLLFTSLWPFSVFYLVWLYVDWDTPNQGGRRSEWIRNRAIWRQLRDYYPVKLVKTAELPPDRNYVLGAHPHGIMCTGFLCNFSTESNGFSQLFPGLRPWLAVLAGLFYLPVYRDYIMSFGLCPVSRQSLDFILSQPQLGQAVVIMVGGAHEALYSVPGEHCLTLQKRKGFVRLALRHGGPPHPRPPAPPPHRGGSQSLSRPLHDGPGAALRGAQGKLWGPRFHLPHLHLGLAAAFR

Gene Information

Entrez Gene ID
Gene Name
monoacylglycerol O-acyltransferase 3
Gene Symbol
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0003846 IEA:UniProtKB-EC F 2-acylglycerol O-acyltransferase activity
GO:0004144 IEA:UniProtKB-EC F diacylglycerol O-acyltransferase activity
GO:0006071 IEA:UniProtKB-KW P glycerol metabolic process
GO:0019432 IEA:UniProtKB-UniPathway P triglyceride biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
hsa04975 Fat digestion and absorption
hsa00561 Glycerolipid metabolism

Domain Information

InterPro Annotations

Accession Description
IPR007130 Diacylglycerol acyltransferase

UniProt Annotations

Entry Information

Gene Name
monoacylglycerol O-acyltransferase 3
Protein Entry
MOGT3_HUMAN
UniProt ID
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q86VF5-1; Sequence=Displayed; Name=2; IsoId=Q86VF5-2; Sequence=VSP_020361, VSP_020362; Note=No experimental confirmation available.; Name=3; IsoId=Q86VF5-3; Sequence=VSP_020363; Note=No experimental confirmation available.;
Biophysicochemical Properties Kinetic parameters: Vmax=9.3 nmol/min/mg enzyme with diacylglycerol as substrate ; Vmax=22.8 nmol/min/mg enzyme with 2-monoacylglycerol as substrate ;
Catalytic Activity Acyl-CoA + 1,2-diacylglycerol = CoA + triacylglycerol.
Catalytic Activity Acyl-CoA + 2-acylglycerol = CoA + diacylglycerol.
Function Catalyzes the formation of diacylglycerol from 2- monoacylglycerol and fatty acyl-CoA. Also able to catalyze the terminal step in triacylglycerol synthesis by using diacylglycerol and fatty acyl-CoA as substrates. Has a preference toward palmitoyl-CoA and oleoyl-CoA. May be involved in absorption of dietary fat in the small intestine by catalyzing the resynthesis of triacylglycerol in enterocytes.
Pathway Glycerolipid metabolism; triacylglycerol biosynthesis.
Sequence Caution Sequence=AAD45832.1; Type=Erroneous gene model prediction; Evidence= ;
Similarity Belongs to the diacylglycerol acyltransferase family.
Subcellular Location Endoplasmic reticulum membrane {ECO
Tissue Specificity Selectively expressed in the digestive system. Highly expressed in the ileum, and at lower level in jejunum, duodenum, colon, cecum and the rectum. Not expressed in the stomach and the esophagus and trachea. Expressed at very low level in liver.

Identical and Related Proteins

Unique RefSeq proteins for LMP006720 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
30039700 RefSeq NP_835470 341 2-acylglycerol O-acyltransferase 3 isoform a
560592026 RefSeq NP_001274076 281 2-acylglycerol O-acyltransferase 3 isoform b

Identical Sequences to LMP006720 proteins

Reference Database Accession Length Protein Name
GI:30039700 EMBL CBU92414.1 341 unnamed protein product [Homo sapiens]
GI:560592026 GenBank AAI00956.1 281 MOGAT3 protein [Homo sapiens]
GI:30039700 GenBank AED72406.1 341 Sequence 8 from patent US 7910346
GI:30039700 GenBank AGC98165.1 341 Sequence 8 from patent US 8334111
GI:30039700 GenBank AGX59581.1 341 Sequence 19441 from patent US 8541208
GI:30039700 GenBank AGX72246.1 341 Sequence 44291 from patent US 8541208
GI:30039700 GenBank AHD69566.1 341 Sequence 580 from patent US 8586006

Related Sequences to LMP006720 proteins

Reference Database Accession Length Protein Name
GI:560592026 EMBL CBF90900.1 341 unnamed protein product [Homo sapiens]
GI:560592026 EMBL CBF67541.1 341 unnamed protein product [Homo sapiens]
GI:30039700 GenBank AAI00954.1 341 Monoacylglycerol O-acyltransferase 3 [Homo sapiens]
GI:560592026 GenBank ACR92671.1 341 Sequence 8 from patent US 7527962
GI:30039700 GenBank EHH52051.1 341 hypothetical protein EGM_12419 [Macaca fascicularis]
GI:560592026 GenBank AGX59581.1 341 Sequence 19441 from patent US 8541208
GI:560592026 GenBank AHD69566.1 341 Sequence 580 from patent US 8586006
GI:30039700 GenBank AIC58191.1 341 MOGAT3, partial [synthetic construct]
GI:30039700 RefSeq XP_527842.3 341 PREDICTED: 2-acylglycerol O-acyltransferase 3 isoform X2 [Pan troglodytes]
GI:30039700 RefSeq XP_003807246.1 341 PREDICTED: 2-acylglycerol O-acyltransferase 3 isoform X2 [Pan paniscus]
GI:30039700 RefSeq XP_008016659.1 341 PREDICTED: 2-acylglycerol O-acyltransferase 3 [Chlorocebus sabaeus]
GI:560592026 RefSeq XP_008957496.1 281 PREDICTED: 2-acylglycerol O-acyltransferase 3 isoform X3 [Pan paniscus]