Gene/Proteome Database (LMPD)
LMPD ID
LMP006721
Gene ID
Species
Homo sapiens (Human)
Gene Name
glycosylphosphatidylinositol anchored molecule like
Gene Symbol
Synonyms
LY6DL
Alternate Names
glycosyl-phosphatidylinositol-anchored molecule-like protein; GPI anchored molecule like protein; Glycosylphosphatidylinositol-anchored molecule-like protein; glycosylphosphatidylinositol anchored molecule like protein
Chromosome
8
Map Location
8q24.3
Proteins
| glycosyl-phosphatidylinositol-anchored molecule-like protein precursor | |
|---|---|
| Refseq ID | NP_002057 |
| Protein GI | 4504033 |
| UniProt ID | Q99445 |
| mRNA ID | NM_002066 |
| Length | 158 |
| RefSeq Status | VALIDATED |
| MLLFALLLAMELPLVAASATMRAQWTYSLRCHDCAVINDFNCPNIRVCPYHIRRCMTISIRINSRELLVYKNCTNNCTFVYAAEQPPEAPGKIFKTNSFYWVCCCNSMVCNAGGPTNLERDMLPDEVTEEELPEGTVRLGVSKLLLSFASIIVSNILP | |
| sig_peptide: 1..17 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 1829 peptide sequence: MLLFALLLAMELPLVAA mat_peptide: 18..158 product: Glycosyl-phosphatidylinositol-anchored molecule-like protein experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q99445.1) calculated_mol_wt: 15919 peptide sequence: SATMRAQWTYSLRCHDCAVINDFNCPNIRVCPYHIRRCMTISIRINSRELLVYKNCTNNCTFVYAAEQPPEAPGKIFKTNSFYWVCCCNSMVCNAGGPTNLERDMLPDEVTEEELPEGTVRLGVSKLLLSFASIIVSNILP | |
Gene Information
Entrez Gene ID
Gene Name
glycosylphosphatidylinositol anchored molecule like
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0031225 | IEA:UniProtKB-KW | C | anchored component of membrane |
| GO:0019898 | TAS:ProtInc | C | extrinsic component of membrane |
| GO:0005886 | TAS:ProtInc | C | plasma membrane |
| GO:0006977 | TAS:ProtInc | P | DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest |
| GO:0006915 | TAS:ProtInc | P | apoptotic process |
| GO:0008285 | TAS:ProtInc | P | negative regulation of cell proliferation |
Domain Information
UniProt Annotations
Entry Information
Gene Name
glycosylphosphatidylinositol anchored molecule like
Protein Entry
GML_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Function | May play a role in the apoptotic pathway or cell-cycle regulation induced by p53/TP53 after DNA damage. |
| Induction | By p53/TP53. |
| Similarity | Contains 1 UPAR/Ly6 domain. |
| Subcellular Location | Cell membrane ; Lipid-anchor, GPI-anchor . |
Identical and Related Proteins
Unique RefSeq proteins for LMP006721 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 4504033 | RefSeq | NP_002057 | 158 | glycosyl-phosphatidylinositol-anchored molecule-like protein precursor |
Identical Sequences to LMP006721 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:4504033 | GenBank | AAH74930.1 | 158 | Glycosylphosphatidylinositol anchored molecule like protein [Homo sapiens] |
| GI:4504033 | GenBank | AAI26337.1 | 158 | Glycosylphosphatidylinositol anchored molecule like protein [Homo sapiens] |
| GI:4504033 | GenBank | AAI26339.1 | 158 | Glycosylphosphatidylinositol anchored molecule like protein [Homo sapiens] |
| GI:4504033 | GenBank | EAW82296.1 | 158 | GPI anchored molecule like protein [Homo sapiens] |
| GI:4504033 | GenBank | ADR82818.1 | 158 | glycosylphosphatidylinositol anchored molecule like protein, partial [synthetic construct] |
| GI:4504033 | GenBank | AIC48845.1 | 158 | GML, partial [synthetic construct] |
Related Sequences to LMP006721 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:4504033 | GenBank | ACM85009.1 | 187 | Sequence 10507 from patent US 6812339 |
| GI:4504033 | GenBank | EHH28803.1 | 158 | Glycosyl-phosphatidylinositol-anchored molecule-like protein [Macaca mulatta] |
| GI:4504033 | RefSeq | XP_528249.2 | 158 | PREDICTED: glycosyl-phosphatidylinositol-anchored molecule-like protein [Pan troglodytes] |
| GI:4504033 | RefSeq | XP_007999894.1 | 300 | PREDICTED: glycosyl-phosphatidylinositol-anchored molecule-like protein isoform X1 [Chlorocebus sabaeus] |
| GI:4504033 | RefSeq | XP_007999896.1 | 232 | PREDICTED: glycosyl-phosphatidylinositol-anchored molecule-like protein isoform X2 [Chlorocebus sabaeus] |
| GI:4504033 | RefSeq | XP_007999897.1 | 158 | PREDICTED: glycosyl-phosphatidylinositol-anchored molecule-like protein isoform X3 [Chlorocebus sabaeus] |