Gene/Proteome Database (LMPD)
LMPD ID
LMP006733
Gene ID
Species
Homo sapiens (Human)
Gene Name
ceramide-1-phosphate transfer protein
Gene Symbol
Synonyms
GLTPD1
Alternate Names
ceramide-1-phosphate transfer protein; GLTP domain-containing protein 1; glycolipid transfer protein domain containing 1; glycolipid transfer protein domain-containing protein 1
Chromosome
1
Map Location
1p36.33
Proteins
| ceramide-1-phosphate transfer protein | |
|---|---|
| Refseq ID | NP_001025056 |
| Protein GI | 71274150 |
| UniProt ID | Q5TA50 |
| mRNA ID | NM_001029885 |
| Length | 214 |
| RefSeq Status | VALIDATED |
| MDDSETGFNLKVVLVSFKQCLDEKEEVLLDPYIASWKGLVRFLNSLGTIFSFISKDVVSKLRIMERLRGGPQSEHYRSLQAMVAHELSNRLVDLERRSHHPESGCRTVLRLHRALHWLQLFLEGLRTSPEDARTSALCADSYNASLAAYHPWVVRRAVTVAFCTLPTREVFLEAMNVGPPEQAVQMLGEALPFIQRVYNVSQKLYAEHSLLDLP | |
Gene Information
Entrez Gene ID
Gene Name
ceramide-1-phosphate transfer protein
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005794 | IEA:UniProtKB-KW | C | Golgi apparatus |
| GO:0005768 | IEA:UniProtKB-KW | C | endosome |
| GO:0005634 | IEA:UniProtKB-KW | C | nucleus |
| GO:0005886 | IEA:UniProtKB-KW | C | plasma membrane |
| GO:1902387 | IDA:UniProtKB | F | ceramide 1-phosphate binding |
| GO:1902388 | IDA:UniProtKB | F | ceramide 1-phosphate transporter activity |
| GO:0051861 | IEA:InterPro | F | glycolipid binding |
| GO:0005543 | IDA:UniProtKB | F | phospholipid binding |
| GO:0005548 | IDA:UniProtKB | F | phospholipid transporter activity |
| GO:1902389 | IDA:UniProtKB | P | ceramide 1-phosphate transport |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR014830 | Glycolipid transfer protein domain |
UniProt Annotations
Entry Information
Gene Name
ceramide-1-phosphate transfer protein
Protein Entry
CPTP_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Function | Mediates the intracellular transfer of ceramide-1- phosphate between organelle membranes and the cell membrane. Required for normal structure of the Golgi stacks. Can bind phosphoceramides with a variety of aliphatic chains, but has a preference for lipids with saturated C16:0 or monounsaturated C18:1 aliphatic chains, and is inefficient with phosphoceramides containing lignoceryl (C24:0). Plays a role in the regulation of the cellular levels of ceramide-1-phosphate, and thereby contributes to the regulation of phospholipase PLA2G4A activity and the release of arachidonic acid. Has no activity with galactosylceramide, lactosylceramide, sphingomyelin, phosphatidylcholine, phosphatidic acid and ceramide. |
| Sequence Caution | Sequence=EAW56230.1; Type=Erroneous gene model prediction; Evidence= ; |
| Similarity | Belongs to the GLTP family. |
| Subcellular Location | Cytoplasm, cytosol . Golgi apparatus, trans-Golgi network membrane ; Peripheral membrane protein . Cell membrane ; Peripheral membrane protein ; Cytoplasmic side . Endosome membrane ; Peripheral membrane protein . Nucleus outer membrane ; Peripheral membrane protein . |
| Tissue Specificity | Ubiquitous. Detected in heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, testis, ovary, small intestine, colon and peripheral blood leukocytes. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006733 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 71274150 | RefSeq | NP_001025056 | 214 | ceramide-1-phosphate transfer protein |
Identical Sequences to LMP006733 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:71274150 | GenBank | JAA15431.1 | 214 | glycolipid transfer protein domain containing 1 [Pan troglodytes] |
| GI:71274150 | GenBank | JAA23250.1 | 214 | glycolipid transfer protein domain containing 1 [Pan troglodytes] |
| GI:71274150 | GenBank | JAA38715.1 | 214 | glycolipid transfer protein domain containing 1 [Pan troglodytes] |
| GI:71274150 | RefSeq | XP_005244858.1 | 214 | PREDICTED: ceramide-1-phosphate transfer protein isoform X1 [Homo sapiens] |
| GI:71274150 | RefSeq | XP_008959965.1 | 214 | PREDICTED: ceramide-1-phosphate transfer protein [Pan paniscus] |
| GI:71274150 | RefSeq | XP_009444655.1 | 214 | PREDICTED: ceramide-1-phosphate transfer protein [Pan troglodytes] |
Related Sequences to LMP006733 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:71274150 | PDB | 4K84 | 215 | Chain A, Crystal Structure Of Human Ceramide-1-phosphate Transfer Protein (cptp) In Complex With 16:0 Ceramide-1-phosphate (16:0-c1p) |
| GI:71274150 | PDB | 4K84 | 215 | Chain B, Crystal Structure Of Human Ceramide-1-phosphate Transfer Protein (cptp) In Complex With 16:0 Ceramide-1-phosphate (16:0-c1p) |
| GI:71274150 | PDB | 4K85 | 215 | Chain A, Crystal Structure Of Human Ceramide-1-phosphate Transfer Protein (cptp) In Complex With 12:0 Ceramide-1-phosphate (12:0-c1p) |
| GI:71274150 | PDB | 4K85 | 215 | Chain B, Crystal Structure Of Human Ceramide-1-phosphate Transfer Protein (cptp) In Complex With 12:0 Ceramide-1-phosphate (12:0-c1p) |
| GI:71274150 | PDB | 4K85 | 215 | Chain C, Crystal Structure Of Human Ceramide-1-phosphate Transfer Protein (cptp) In Complex With 12:0 Ceramide-1-phosphate (12:0-c1p) |
| GI:71274150 | PDB | 4K85 | 215 | Chain D, Crystal Structure Of Human Ceramide-1-phosphate Transfer Protein (cptp) In Complex With 12:0 Ceramide-1-phosphate (12:0-c1p) |