Gene/Proteome Database (LMPD)

LMPD ID
LMP006749
Gene ID
Species
Homo sapiens (Human)
Gene Name
hydroxysteroid (17-beta) dehydrogenase 14
Gene Symbol
Synonyms
DHRS10; SDR47C1; retSDR3
Alternate Names
17-beta-hydroxysteroid dehydrogenase 14; 17-beta-HSD 14; 17-beta-hydroxysteroid dehydrogenase DHRS10; dehydrogenase/reductase SDR family member 10; retinal short-chain dehydrogenase/reductase 3; dehydrogenase/reductase (SDR family) member 10; retinal short-chain dehydrogenase/reductase retSDR3; short chain dehydrogenase/reductase family 47C, member 1
Chromosome
19
Map Location
19q13.33
EC Number
1.1.1.-
Summary
17-beta-hydroxysteroid dehydrogenases, such as HSD17B14, are primarily involved in metabolism of steroids at the C17 position and also of other substrates, such as fatty acids, prostaglandins, and xenobiotics (Lukacik et al., 2007 [PubMed 17067289]).[supplied by OMIM, Jun 2009]
Orthologs

Proteins

17-beta-hydroxysteroid dehydrogenase 14
Refseq ID NP_057330
Protein GI 59889578
UniProt ID Q9BPX1
mRNA ID NM_016246
Length 270
RefSeq Status VALIDATED
MATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIPS

Gene Information

Entrez Gene ID
Gene Name
hydroxysteroid (17-beta) dehydrogenase 14
Gene Symbol
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005829 IDA:HGNC C cytosol
GO:0004303 IDA:HGNC F estradiol 17-beta-dehydrogenase activity
GO:0047045 IDA:HGNC F testosterone 17-beta-dehydrogenase (NADP+) activity
GO:0006706 IDA:HGNC P steroid catabolic process

Domain Information

InterPro Annotations

Accession Description
IPR002347 Glucose/ribitol dehydrogenase
IPR016040 NAD(P)-binding domain
IPR002198 Short-chain dehydrogenase/reductase SDR
IPR020904 Short-chain dehydrogenase/reductase, conserved site

UniProt Annotations

Entry Information

Gene Name
hydroxysteroid (17-beta) dehydrogenase 14
Protein Entry
DHB14_HUMAN
UniProt ID
Species
Human

Comments

Comment Type Description
Function Has NAD-dependent 17-beta-hydroxysteroid dehydrogenase activity. Converts oestradiol to oestrone. The physiological substrate is not known. Acts on oestradiol and 5-androstene-3- beta,17-beta-diol (in vitro).
Interaction Q6ZVK8:NUDT18; NbExp=3; IntAct=EBI-742664, EBI-740486; Q96HA8:WDYHV1; NbExp=3; IntAct=EBI-742664, EBI-741158;
Similarity Belongs to the short-chain dehydrogenases/reductases (SDR) family.
Subcellular Location Cytoplasm .
Subunit Homotetramer.
Tissue Specificity Highly expressed in brain, placenta, liver and kidney. {ECO

Identical and Related Proteins

Unique RefSeq proteins for LMP006749 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
59889578 RefSeq NP_057330 270 17-beta-hydroxysteroid dehydrogenase 14

Identical Sequences to LMP006749 proteins

Reference Database Accession Length Protein Name
GI:59889578 DBBJ BAI46786.1 270 hydroxysteroid (17-beta) dehydrogenase 14, partial [synthetic construct]
GI:59889578 GenBank ACE31269.1 270 Sequence 468 from patent US 7371836
GI:59889578 GenBank ACN08757.1 270 Sequence 468 from patent US 7488795
GI:59889578 GenBank ADM02160.1 270 Sequence 468 from patent US 7723488
GI:59889578 GenBank ADQ32519.1 270 hydroxysteroid (17-beta) dehydrogenase 14, partial [synthetic construct]
GI:59889578 GenBank AIC51425.1 270 HSD17B14, partial [synthetic construct]

Related Sequences to LMP006749 proteins

Reference Database Accession Length Protein Name
GI:59889578 PDB 1YDE 270 Chain A, Crystal Structure Of Human Retinal Short-Chain DehydrogenaseREDUCTASE 3
GI:59889578 PDB 1YDE 270 Chain B, Crystal Structure Of Human Retinal Short-Chain DehydrogenaseREDUCTASE 3
GI:59889578 PDB 1YDE 270 Chain C, Crystal Structure Of Human Retinal Short-Chain DehydrogenaseREDUCTASE 3
GI:59889578 PDB 1YDE 270 Chain D, Crystal Structure Of Human Retinal Short-Chain DehydrogenaseREDUCTASE 3
GI:59889578 PDB 1YDE 270 Chain E, Crystal Structure Of Human Retinal Short-Chain DehydrogenaseREDUCTASE 3
GI:59889578 PDB 1YDE 270 Chain F, Crystal Structure Of Human Retinal Short-Chain DehydrogenaseREDUCTASE 3