Gene/Proteome Database (LMPD)
LMPD ID
LMP006749
Gene ID
Species
Homo sapiens (Human)
Gene Name
hydroxysteroid (17-beta) dehydrogenase 14
Gene Symbol
Synonyms
DHRS10; SDR47C1; retSDR3
Alternate Names
17-beta-hydroxysteroid dehydrogenase 14; 17-beta-HSD 14; 17-beta-hydroxysteroid dehydrogenase DHRS10; dehydrogenase/reductase SDR family member 10; retinal short-chain dehydrogenase/reductase 3; dehydrogenase/reductase (SDR family) member 10; retinal short-chain dehydrogenase/reductase retSDR3; short chain dehydrogenase/reductase family 47C, member 1
Chromosome
19
Map Location
19q13.33
EC Number
1.1.1.-
Summary
17-beta-hydroxysteroid dehydrogenases, such as HSD17B14, are primarily involved in metabolism of steroids at the C17 position and also of other substrates, such as fatty acids, prostaglandins, and xenobiotics (Lukacik et al., 2007 [PubMed 17067289]).[supplied by OMIM, Jun 2009]
Orthologs
Proteins
| 17-beta-hydroxysteroid dehydrogenase 14 | |
|---|---|
| Refseq ID | NP_057330 |
| Protein GI | 59889578 |
| UniProt ID | Q9BPX1 |
| mRNA ID | NM_016246 |
| Length | 270 |
| RefSeq Status | VALIDATED |
| MATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIPS | |
Gene Information
Entrez Gene ID
Gene Name
hydroxysteroid (17-beta) dehydrogenase 14
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005829 | IDA:HGNC | C | cytosol |
| GO:0004303 | IDA:HGNC | F | estradiol 17-beta-dehydrogenase activity |
| GO:0047045 | IDA:HGNC | F | testosterone 17-beta-dehydrogenase (NADP+) activity |
| GO:0006706 | IDA:HGNC | P | steroid catabolic process |
Domain Information
UniProt Annotations
Entry Information
Gene Name
hydroxysteroid (17-beta) dehydrogenase 14
Protein Entry
DHB14_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Function | Has NAD-dependent 17-beta-hydroxysteroid dehydrogenase activity. Converts oestradiol to oestrone. The physiological substrate is not known. Acts on oestradiol and 5-androstene-3- beta,17-beta-diol (in vitro). |
| Interaction | Q6ZVK8:NUDT18; NbExp=3; IntAct=EBI-742664, EBI-740486; Q96HA8:WDYHV1; NbExp=3; IntAct=EBI-742664, EBI-741158; |
| Similarity | Belongs to the short-chain dehydrogenases/reductases (SDR) family. |
| Subcellular Location | Cytoplasm . |
| Subunit | Homotetramer. |
| Tissue Specificity | Highly expressed in brain, placenta, liver and kidney. {ECO |
Identical and Related Proteins
Unique RefSeq proteins for LMP006749 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 59889578 | RefSeq | NP_057330 | 270 | 17-beta-hydroxysteroid dehydrogenase 14 |
Identical Sequences to LMP006749 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:59889578 | DBBJ | BAI46786.1 | 270 | hydroxysteroid (17-beta) dehydrogenase 14, partial [synthetic construct] |
| GI:59889578 | GenBank | ACE31269.1 | 270 | Sequence 468 from patent US 7371836 |
| GI:59889578 | GenBank | ACN08757.1 | 270 | Sequence 468 from patent US 7488795 |
| GI:59889578 | GenBank | ADM02160.1 | 270 | Sequence 468 from patent US 7723488 |
| GI:59889578 | GenBank | ADQ32519.1 | 270 | hydroxysteroid (17-beta) dehydrogenase 14, partial [synthetic construct] |
| GI:59889578 | GenBank | AIC51425.1 | 270 | HSD17B14, partial [synthetic construct] |
Related Sequences to LMP006749 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:59889578 | PDB | 1YDE | 270 | Chain A, Crystal Structure Of Human Retinal Short-Chain DehydrogenaseREDUCTASE 3 |
| GI:59889578 | PDB | 1YDE | 270 | Chain B, Crystal Structure Of Human Retinal Short-Chain DehydrogenaseREDUCTASE 3 |
| GI:59889578 | PDB | 1YDE | 270 | Chain C, Crystal Structure Of Human Retinal Short-Chain DehydrogenaseREDUCTASE 3 |
| GI:59889578 | PDB | 1YDE | 270 | Chain D, Crystal Structure Of Human Retinal Short-Chain DehydrogenaseREDUCTASE 3 |
| GI:59889578 | PDB | 1YDE | 270 | Chain E, Crystal Structure Of Human Retinal Short-Chain DehydrogenaseREDUCTASE 3 |
| GI:59889578 | PDB | 1YDE | 270 | Chain F, Crystal Structure Of Human Retinal Short-Chain DehydrogenaseREDUCTASE 3 |