Gene/Proteome Database (LMPD)
LMPD ID
LMP006751
Gene ID
Species
Homo sapiens (Human)
Gene Name
insulin induced gene 2
Gene Symbol
Synonyms
-
Alternate Names
insulin-induced gene 2 protein; INSIG-2; INSIG2 membrane protein; insulin induced protein 2
Chromosome
2
Map Location
2q14.2
Summary
The protein encoded by this gene is highly similar to the protein product encoded by gene INSIG1. Both INSIG1 protein and this protein are endoplasmic reticulum proteins that block the processing of sterol regulatory element binding proteins (SREBPs) by binding to SREBP cleavage-activating protein (SCAP), and thus prevent SCAP from escorting SREBPs to the Golgi. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
insulin-induced gene 2 protein | |
---|---|
Refseq ID | NP_057217 |
Protein GI | 38327533 |
UniProt ID | Q9Y5U4 |
mRNA ID | NM_016133 |
Length | 225 |
RefSeq Status | REVIEWED |
MAEGETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQIQRNVTLFPPDVIASIFSSAWWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINHASAKVDFDNNIQLSLTLAALSIGLWWTFDRSRSGFGLGVGIAFLATVVTQLLVYNGVYQYTSPDFLYVRSWLPCIFFAGGITMGNIGRQLAMYECKVIAEKSHQE |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005789 | TAS:Reactome | C | endoplasmic reticulum membrane |
GO:0032937 | IDA:UniProtKB | C | SREBP-SCAP-Insig complex |
GO:0006695 | IEA:Ensembl | P | cholesterol biosynthetic process |
GO:0060363 | IEA:Ensembl | P | cranial suture morphogenesis |
GO:0042472 | IEA:Ensembl | P | inner ear morphogenesis |
GO:0042474 | IEA:Ensembl | P | middle ear morphogenesis |
GO:0045717 | IEA:Ensembl | P | negative regulation of fatty acid biosynthetic process |
GO:0010894 | IEA:Ensembl | P | negative regulation of steroid biosynthetic process |
GO:0060021 | IEA:Ensembl | P | palate development |
GO:0070542 | IEA:Ensembl | P | response to fatty acid |
GO:0032868 | IEA:Ensembl | P | response to insulin |
GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
GO:0032933 | IDA:UniProtKB | P | SREBP signaling pathway |
GO:0006641 | IEA:Ensembl | P | triglyceride metabolic process |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
REACT_111217 | Metabolism |
REACT_22258 | Metabolism of lipids and lipoproteins |
REACT_147797 | Regulation of cholesterol biosynthesis by SREBP (SREBF) |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR025929 | Insulin-induced protein family |
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Function | Mediates feedback control of cholesterol synthesis by controlling SCAP and HMGCR. Functions by blocking the processing of sterol regulatory element-binding proteins (SREBPs). Capable of retaining the SCAP-SREBF2 complex in the ER thus preventing it from escorting SREBPs to the Golgi. Seems to regulate the ubiquitin-mediated proteasomal degradation of HMGCR. |
Miscellaneous | Does not require nuclear SREBPs for its expression. When nuclear SREBP activity is low, is the only form of INSIG present in the cell. |
Sequence Caution | Sequence=AAD43048.1; Type=Frameshift; Positions=221; Evidence= ; |
Similarity | Belongs to the INSIG family. |
Subcellular Location | Endoplasmic reticulum membrane ; Multi-pass membrane protein . |
Subunit | Binds to the SCAP-SREBF2 complex only in the presence of sterols. Interacts with RNF139. {ECO |
Identical and Related Proteins
Unique RefSeq proteins for LMP006751 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
38327533 | RefSeq | NP_057217 | 225 | insulin-induced gene 2 protein |
Identical Sequences to LMP006751 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:38327533 | RefSeq | XP_008256705.1 | 225 | PREDICTED: insulin-induced gene 2 protein isoform X1 [Oryctolagus cuniculus] |
GI:38327533 | RefSeq | XP_008256706.1 | 225 | PREDICTED: insulin-induced gene 2 protein isoform X1 [Oryctolagus cuniculus] |
GI:38327533 | RefSeq | XP_008970733.1 | 225 | PREDICTED: insulin-induced gene 2 protein [Pan paniscus] |
GI:38327533 | RefSeq | XP_008970734.1 | 225 | PREDICTED: insulin-induced gene 2 protein [Pan paniscus] |
GI:38327533 | RefSeq | XP_009441443.1 | 225 | PREDICTED: insulin-induced gene 2 protein isoform X1 [Pan troglodytes] |
GI:38327533 | RefSeq | XP_009441444.1 | 225 | PREDICTED: insulin-induced gene 2 protein isoform X1 [Pan troglodytes] |
Related Sequences to LMP006751 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:38327533 | RefSeq | NP_001162382.1 | 225 | insulin-induced gene 2 protein [Papio anubis] |
GI:38327533 | RefSeq | XP_002799451.1 | 225 | PREDICTED: insulin-induced gene 2 protein-like isoform 2 [Macaca mulatta] |
GI:38327533 | RefSeq | XP_007962930.1 | 225 | PREDICTED: insulin-induced gene 2 protein isoform X1 [Chlorocebus sabaeus] |
GI:38327533 | RefSeq | XP_007962931.1 | 225 | PREDICTED: insulin-induced gene 2 protein isoform X1 [Chlorocebus sabaeus] |
GI:38327533 | RefSeq | XP_007962932.1 | 225 | PREDICTED: insulin-induced gene 2 protein isoform X1 [Chlorocebus sabaeus] |
GI:38327533 | SwissProt | A9RA88.1 | 225 | RecName: Full=Insulin-induced gene 2 protein; Short=INSIG-2 [Papio anubis] |