Gene/Proteome Database (LMPD)

LMPD ID
LMP006751
Gene ID
51141
Species
Homo sapiens (Human)
Gene Name
insulin induced gene 2
Gene Symbol
INSIG2
Synonyms
-
Alternate Names
insulin-induced gene 2 protein; INSIG-2; INSIG2 membrane protein; insulin induced protein 2
Chromosome
2
Map Location
2q14.2
Summary
The protein encoded by this gene is highly similar to the protein product encoded by gene INSIG1. Both INSIG1 protein and this protein are endoplasmic reticulum proteins that block the processing of sterol regulatory element binding proteins (SREBPs) by binding to SREBP cleavage-activating protein (SCAP), and thus prevent SCAP from escorting SREBPs to the Golgi. [provided by RefSeq, Jul 2008]
Orthologs
View orthologs and multiple alignments for INSIG2

Proteins

insulin-induced gene 2 protein
Refseq ID NP_057217
Protein GI 38327533
UniProt ID Q9Y5U4
mRNA ID NM_016133
Length 225
RefSeq Status REVIEWED
MAEGETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQIQRNVTLFPPDVIASIFSSAWWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINHASAKVDFDNNIQLSLTLAALSIGLWWTFDRSRSGFGLGVGIAFLATVVTQLLVYNGVYQYTSPDFLYVRSWLPCIFFAGGITMGNIGRQLAMYECKVIAEKSHQE

Gene Information

Entrez Gene ID
51141
Gene Name
insulin induced gene 2
Gene Symbol
INSIG2
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0032937 IDA:UniProtKB C SREBP-SCAP-Insig complex
GO:0005789 TAS:Reactome C endoplasmic reticulum membrane
GO:0032933 IDA:UniProtKB P SREBP signaling pathway
GO:0006695 IEA:Ensembl P cholesterol biosynthetic process
GO:0060363 IEA:Ensembl P cranial suture morphogenesis
GO:0042472 IEA:Ensembl P inner ear morphogenesis
GO:0042474 IEA:Ensembl P middle ear morphogenesis
GO:0045717 IEA:Ensembl P negative regulation of fatty acid biosynthetic process
GO:0010894 IEA:Ensembl P negative regulation of steroid biosynthetic process
GO:0060021 IEA:Ensembl P palate development
GO:0070542 IEA:Ensembl P response to fatty acid
GO:0032868 IEA:Ensembl P response to insulin
GO:0044281 TAS:Reactome P small molecule metabolic process
GO:0006641 IEA:Ensembl P triglyceride metabolic process

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_111217 Metabolism
REACT_22258 Metabolism of lipids and lipoproteins
REACT_147797 Regulation of cholesterol biosynthesis by SREBP (SREBF)

Domain Information

InterPro Annotations

Accession Description
IPR025929 Insulin-induced protein family

UniProt Annotations

Entry Information

Gene Name
insulin induced gene 2
Protein Entry
INSI2_HUMAN
UniProt ID
Q9Y5U4
Species
Human

Comments

Comment Type Description
Function Mediates feedback control of cholesterol synthesis by controlling SCAP and HMGCR. Functions by blocking the processing of sterol regulatory element-binding proteins (SREBPs). Capable of retaining the SCAP-SREBF2 complex in the ER thus preventing it from escorting SREBPs to the Golgi. Seems to regulate the ubiquitin-mediated proteasomal degradation of HMGCR.
Miscellaneous Does not require nuclear SREBPs for its expression. When nuclear SREBP activity is low, is the only form of INSIG present in the cell.
Sequence Caution Sequence=AAD43048.1; Type=Frameshift; Positions=221; Evidence= ;
Similarity Belongs to the INSIG family.
Subcellular Location Endoplasmic reticulum membrane ; Multi-pass membrane protein .
Subunit Binds to the SCAP-SREBF2 complex only in the presence of sterols. Interacts with RNF139. {ECO

Identical and Related Proteins

Unique RefSeq proteins for LMP006751 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
38327533 RefSeq NP_057217 225 insulin-induced gene 2 protein

Identical Sequences to LMP006751 proteins

Reference Database Accession Length Protein Name
GI:38327533 RefSeq XP_008256705.1 225 PREDICTED: insulin-induced gene 2 protein isoform X1 [Oryctolagus cuniculus]
GI:38327533 RefSeq XP_008256706.1 225 PREDICTED: insulin-induced gene 2 protein isoform X1 [Oryctolagus cuniculus]
GI:38327533 RefSeq XP_008970733.1 225 PREDICTED: insulin-induced gene 2 protein [Pan paniscus]
GI:38327533 RefSeq XP_008970734.1 225 PREDICTED: insulin-induced gene 2 protein [Pan paniscus]
GI:38327533 RefSeq XP_009441443.1 225 PREDICTED: insulin-induced gene 2 protein isoform X1 [Pan troglodytes]
GI:38327533 RefSeq XP_009441444.1 225 PREDICTED: insulin-induced gene 2 protein isoform X1 [Pan troglodytes]

Related Sequences to LMP006751 proteins

Reference Database Accession Length Protein Name
GI:38327533 RefSeq NP_001162382.1 225 insulin-induced gene 2 protein [Papio anubis]
GI:38327533 RefSeq XP_002799451.1 225 PREDICTED: insulin-induced gene 2 protein-like isoform 2 [Macaca mulatta]
GI:38327533 RefSeq XP_007962930.1 225 PREDICTED: insulin-induced gene 2 protein isoform X1 [Chlorocebus sabaeus]
GI:38327533 RefSeq XP_007962931.1 225 PREDICTED: insulin-induced gene 2 protein isoform X1 [Chlorocebus sabaeus]
GI:38327533 RefSeq XP_007962932.1 225 PREDICTED: insulin-induced gene 2 protein isoform X1 [Chlorocebus sabaeus]
GI:38327533 SwissProt A9RA88.1 225 RecName: Full=Insulin-induced gene 2 protein; Short=INSIG-2 [Papio anubis]