Gene/Proteome Database (LMPD)
LMPD ID
LMP006758
Gene ID
Species
Homo sapiens (Human)
Gene Name
N-acylsphingosine amidohydrolase (non-lysosomal ceramidase) 2B
Gene Symbol
Synonyms
ASAH2C; ASAH2L; bA449O16.3
Alternate Names
putative inactive neutral ceramidase B; ASAH2-like protein; putative inactive non-lysosomal ceramidase B; putative inactive N-acylsphingosine amidohydrolase 2B
Chromosome
10
Map Location
10q11.23
Proteins
| putative inactive neutral ceramidase B | |
|---|---|
| Refseq ID | NP_001072984 |
| Protein GI | 118442845 |
| UniProt ID | P0C7U1 |
| mRNA ID | NM_001079516 |
| Length | 165 |
| RefSeq Status | PROVISIONAL |
| MRQHRQFMDRTHYLLTFSSSETLLRLLLRIVDRAPKGRTFGDVLQPAKPEYRVGEVAEVIFVGANPKNSVQNQTHQTFLTVEKYEATSTSWQIVCNDASWETRFYWHKGLLGLSNATVEWHIPDTAQPGIYRIRYFGHNRKQDILKPAVILSFEGTSPAFEVVTI | |
Gene Information
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR006823 | Neutral/alkaline nonlysosomal ceramidase |
UniProt Annotations
Entry Information
Gene Name
N-acylsphingosine amidohydrolase (non-lysosomal ceramidase) 2B
Protein Entry
ASA2B_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P0C7U1-1; Sequence=Displayed; Name=2; IsoId=P0C7U1-2; Sequence=VSP_056938; Note=No experimental confirmation available; |
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P0C7U1-1; Sequence=Displayed; Name=2; IsoId=P0C7U1-2; Sequence=VSP_056938; Note=No experimental confirmation available; |
| Caution | In contrast to other members of the family, ASAH2B has no predicted transmembrane domain, and lacks the active site, suggesting that it may be catalytically inactive. |
| Caution | In contrast to other members of the family, ASAH2B has no predicted transmembrane domain, and lacks the active site, suggesting that it may be catalytically inactive. {ECO:0000305}. |
| Miscellaneous | ASAH2B/ASAH2L is a partial paralog of ASAH2, resulting from a partial duplication of ASAH2 on chromosome 10. It has a polymorphic start codon with a single nucleotide change of the original ASAH2 sequence plus other putative translation start site that might lead to several potential ORFs. |
| Similarity | Belongs to the neutral ceramidase family. |
| Similarity | Belongs to the neutral ceramidase family. {ECO:0000305}. |
| Tissue Specificity | Ubiquitous. Expression is reduced with increasing age and in late-onset Alzheimer disease (LOAD) patients. This reduction is even more pronounced in patients with an affected mother. |
| Tissue Specificity | Ubiquitous. Expression is reduced with increasing age and in late-onset Alzheimer disease (LOAD) patients. This reduction is even more pronounced in patients with an affected mother. {ECO:0000269|PubMed:17334805}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006758 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 118442845 | RefSeq | NP_001072984 | 165 | putative inactive neutral ceramidase B |
Identical Sequences to LMP006758 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:118442845 | GenBank | AHE02262.1 | 165 | Sequence 60616 from patent US 8586006 |
| GI:118442845 | RefSeq | XP_006718015.1 | 165 | PREDICTED: putative inactive neutral ceramidase B isoform X3 [Homo sapiens] |
| GI:118442845 | SwissProt | P0C7U1.1 | 165 | RecName: Full=Putative inactive neutral ceramidase B; AltName: Full=ASAH2-like protein; AltName: Full=Putative inactive N-acylsphingosine amidohydrolase 2B; AltName: Full=Putative inactive non-lysosomal ceramidase B [Homo sapiens] |
Related Sequences to LMP006758 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:118442845 | DBBJ | BAH11747.1 | 160 | unnamed protein product [Homo sapiens] |
| GI:118442845 | EMBL | CAC60194.1 | 761 | unnamed protein product [Homo sapiens] |
| GI:118442845 | GenBank | AHE02261.1 | 160 | Sequence 60615 from patent US 8586006 |
| GI:118442845 | GenBank | AHE02263.1 | 160 | Sequence 60617 from patent US 8586006 |
| GI:118442845 | RefSeq | XP_005270116.1 | 160 | PREDICTED: putative inactive neutral ceramidase B isoform X1 [Homo sapiens] |
| GI:118442845 | RefSeq | XP_005270117.1 | 160 | PREDICTED: putative inactive neutral ceramidase B isoform X2 [Homo sapiens] |