Gene/Proteome Database (LMPD)
LMPD ID
LMP006780
Gene ID
Species
Homo sapiens (Human)
Gene Name
StAR-related lipid transfer (START) domain containing 7
Gene Symbol
Synonyms
GTT1
Alternate Names
stAR-related lipid transfer protein 7, mitochondrial; START domain containing 7; START domain-containing protein 7; gestational trophoblastic tumor protein 1
Chromosome
2
Map Location
2q11.2
Summary
Although the function of this gene is not known, its existence is supported by mRNA and EST data. The predicted gene product contains a region similar to the STAR-related lipid transfer (START) domain, which is often present in proteins involved in the cell signaling mediated by lipid binding. Alternatively spliced transcript variants have been described, although some transcripts occur only in cancer cell lines. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
| stAR-related lipid transfer protein 7, mitochondrial precursor | |
|---|---|
| Refseq ID | NP_064536 |
| Protein GI | 151301035 |
| UniProt ID | Q9NQZ5 |
| mRNA ID | NM_020151 |
| Length | 370 |
| RefSeq Status | VALIDATED |
| MLPRRLLAAWLAGTRGGGLLALLANQCRFVTGLRVRRAQQIAQLYGRLYSESSRRVLLGRLWRRLHGRPGHASALMAALAGVFVWDEERIQEEELQRSINEMKRLEEMSNMFQSSGVQHHPPEPKAQTEGNEDSEGKEQRWEMVMDKKHFKLWRRPITGTHLYQYRVFGTYTDVTPRQFFNVQLDTEYRKKWDALVIKLEVIERDVVSGSEVLHWVTHFPYPMYSRDYVYVRRYSVDQENNMMVLVSRAVEHPSVPESPEFVRVRSYESQMVIRPHKSFDENGFDYLLTYSDNPQTVFPRYCVSWMVSSGMPDFLEKLHMATLKAKNMEIKVKDYISAKPLEMSSEAKATSQSSERKNEGSCGPARIEYA | |
| transit_peptide: 1..58 inference: non-experimental evidence, no additional details recorded note: Mitochondrion (Potential); propagated from UniProtKB/Swiss-Prot (Q9NQZ5.2) calculated_mol_wt: 6512 peptide sequence: MLPRRLLAAWLAGTRGGGLLALLANQCRFVTGLRVRRAQQIAQLYGRLYSESSRRVLL mat_peptide: 59..370 product: StAR-related lipid transfer protein 7, mitochondrial experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q9NQZ5.2) calculated_mol_wt: 36620 peptide sequence: GRLWRRLHGRPGHASALMAALAGVFVWDEERIQEEELQRSINEMKRLEEMSNMFQSSGVQHHPPEPKAQTEGNEDSEGKEQRWEMVMDKKHFKLWRRPITGTHLYQYRVFGTYTDVTPRQFFNVQLDTEYRKKWDALVIKLEVIERDVVSGSEVLHWVTHFPYPMYSRDYVYVRRYSVDQENNMMVLVSRAVEHPSVPESPEFVRVRSYESQMVIRPHKSFDENGFDYLLTYSDNPQTVFPRYCVSWMVSSGMPDFLEKLHMATLKAKNMEIKVKDYISAKPLEMSSEAKATSQSSERKNEGSCGPARIEYA | |
Gene Information
Entrez Gene ID
Gene Name
StAR-related lipid transfer (START) domain containing 7
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005739 | IEA:UniProtKB-KW | C | mitochondrion |
| GO:0008289 | IEA:InterPro | F | lipid binding |
Domain Information
UniProt Annotations
Entry Information
Gene Name
StAR-related lipid transfer (START) domain containing 7
Protein Entry
STAR7_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Sequence Caution | Sequence=AAF81750.1; Type=Frameshift; Positions=53; Evidence= ; Sequence=AAH07894.1; Type=Erroneous initiation; Evidence= ; Sequence=AAH08894.1; Type=Erroneous initiation; Evidence= ; Sequence=AAH09998.1; Type=Erroneous initiation; Evidence= ; Sequence=AAH12774.1; Type=Erroneous initiation; Evidence= ; Sequence=AAH12793.1; Type=Erroneous initiation; Evidence= ; Sequence=AAH13279.1; Type=Erroneous initiation; Evidence= ; Sequence=AAH14076.1; Type=Erroneous initiation; Evidence= ; Sequence=AAH14274.3; Type=Erroneous initiation; Evidence= ; Sequence=AAH32106.1; Type=Erroneous initiation; Evidence= ; |
| Similarity | Contains 1 START domain. {ECO |
| Subcellular Location | Mitochondrion . |
Identical and Related Proteins
Unique RefSeq proteins for LMP006780 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 151301035 | RefSeq | NP_064536 | 370 | stAR-related lipid transfer protein 7, mitochondrial precursor |
Identical Sequences to LMP006780 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:151301035 | DBBJ | BAI45791.1 | 370 | StAR-related lipid transfer (START) domain containing 7, partial [synthetic construct] |
| GI:151301035 | GenBank | EAW71382.1 | 370 | START domain containing 7, isoform CRA_a [Homo sapiens] |
| GI:151301035 | GenBank | EAW71383.1 | 370 | START domain containing 7, isoform CRA_a [Homo sapiens] |
| GI:151301035 | GenBank | ADF25061.1 | 370 | Sequence 270 from patent US 7691599 |
| GI:151301035 | SwissProt | Q9NQZ5.2 | 370 | RecName: Full=StAR-related lipid transfer protein 7, mitochondrial; AltName: Full=Gestational trophoblastic tumor protein 1; AltName: Full=START domain-containing protein 7; Short=StARD7; Flags: Precursor [Homo sapiens] |
Related Sequences to LMP006780 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:151301035 | GenBank | JAA07723.1 | 370 | StAR-related lipid transfer (START) domain containing 7 [Pan troglodytes] |
| GI:151301035 | GenBank | JAA16516.1 | 370 | StAR-related lipid transfer (START) domain containing 7 [Pan troglodytes] |
| GI:151301035 | GenBank | JAA16517.1 | 370 | StAR-related lipid transfer (START) domain containing 7 [Pan troglodytes] |
| GI:151301035 | GenBank | JAA16518.1 | 370 | StAR-related lipid transfer (START) domain containing 7 [Pan troglodytes] |
| GI:151301035 | GenBank | JAA31186.1 | 370 | StAR-related lipid transfer (START) domain containing 7 [Pan troglodytes] |
| GI:151301035 | RefSeq | XP_009441145.1 | 370 | PREDICTED: stAR-related lipid transfer protein 7, mitochondrial [Pan troglodytes] |