Gene/Proteome Database (LMPD)

LMPD ID
LMP006783
Gene ID
84992
Species
Homo sapiens (Human)
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class Y
Gene Symbol
PIGY
Synonyms
PIG-Y
Alternate Names
phosphatidylinositol N-acetylglucosaminyltransferase subunit Y; phosphatidylinositol-glycan biosynthesis class Y protein
Chromosome
4
Map Location
4q22.1
Summary
The protein encoded by this gene is part of the GPI-N-acetylglucosaminyltransferase (GIP-GnT) complex which initiates the biosynthesis of glycosylphosphatidylinositol (GPI). GPI is synthesized in the endoplasmic reticulum and serves as an anchor for many surface proteins. Proteins containing GPI anchors can have an important role in cell-cell interactions. The transcript for this gene is bicistronic. The downstream open reading frame encodes this GPI-GnT complex protein, while the upstream open reading frame encodes a protein with unknown function, as represented by GeneID:100996939. [provided by RefSeq, Aug 2012]
Orthologs
View orthologs and multiple alignments for PIGY

Proteins

phosphatidylinositol N-acetylglucosaminyltransferase subunit Y
Refseq ID NP_001036081
Protein GI 111494230
UniProt ID Q3MUY2
mRNA ID NM_001042616
Length 71
RefSeq Status REVIEWED
MFLSLPTLTVLIPLVSLAGLFYSASVEENFPQGCTSTASLCFYSLLLPITIPVYVFFHLWTWMGIKLFRHN

Gene Information

Entrez Gene ID
84992
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class Y
Gene Symbol
PIGY
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005789 IDA:MGI C endoplasmic reticulum membrane
GO:0000506 IDA:MGI C glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005886 IDA:MGI C plasma membrane
GO:0006506 IDA:MGI P GPI anchor biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
hsa00563 Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
ko00563 Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
hsa01100 Metabolic pathways

Domain Information

InterPro Annotations

Accession Description
IPR029164 Phosphatidylinositol N-acetylglucosaminyltransferase subunit Y

UniProt Annotations

Entry Information

Gene Name
phosphatidylinositol glycan anchor biosynthesis, class Y
Protein Entry
PIGY_HUMAN
UniProt ID
Q3MUY2
Species
Human

Comments

Comment Type Description
Function Component of the GPI-GlcNAc transferase (GPI-GnT) complex in the endoplasmic reticulum, a complex that catalyzes transfer of GlcNAc from UDP-GlcNAc to an acceptor phosphatidylinositol, the first step in the production of GPI- anchors for cell surface proteins. May act by regulating the catalytic subunit PIGA.
Miscellaneous PREY and PIGY, 2 apparently unrelated proteins, are respectively the product of an upstream and a downstream ORF contained in a single bicistronic transcript.
Pathway Glycolipid biosynthesis; glycosylphosphatidylinositol- anchor biosynthesis.
Subcellular Location Endoplasmic reticulum membrane ; Multi-pass membrane protein .
Subunit Interacts with the GPI-GnT complex composed of PIGA, PIGC, PIGH, PIGP, PIGQ and DPM2. Interacts directly with PIGA. Does not interact with Ras proteins.

Identical and Related Proteins

Unique RefSeq proteins for LMP006783 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
111494230 RefSeq NP_001036081 71 phosphatidylinositol N-acetylglucosaminyltransferase subunit Y

Identical Sequences to LMP006783 proteins

Reference Database Accession Length Protein Name
GI:111494230 GenBank AIC52650.1 71 PIGY, partial [synthetic construct]
GI:111494230 RefSeq XP_004039161.1 71 PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase subunit Y-like isoform 2 [Gorilla gorilla gorilla]
GI:111494230 RefSeq XP_004390191.1 71 PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase subunit Y-like [Trichechus manatus latirostris]
GI:111494230 RefSeq XP_008055688.1 71 PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase subunit Y [Tarsius syrichta]
GI:111494230 RefSeq XP_008961910.1 71 PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase subunit Y [Pan paniscus]
GI:111494230 RefSeq XP_010333087.1 71 PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase subunit Y [Saimiri boliviensis boliviensis]

Related Sequences to LMP006783 proteins

Reference Database Accession Length Protein Name
GI:111494230 RefSeq NP_001252697.1 71 phosphatidylinositol N-acetylglucosaminyltransferase subunit Y [Macaca mulatta]
GI:111494230 RefSeq XP_005337582.1 71 PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase subunit Y-like isoform X2 [Ictidomys tridecemlineatus]
GI:111494230 RefSeq XP_005555453.1 71 PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase subunit Y-like isoform X2 [Macaca fascicularis]
GI:111494230 RefSeq XP_005555454.1 71 PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase subunit Y-like isoform X3 [Macaca fascicularis]
GI:111494230 RefSeq XP_007997420.1 71 PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase subunit Y [Chlorocebus sabaeus]
GI:111494230 RefSeq XP_002815009.2 71 PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase subunit Y [Pongo abelii]