Gene/Proteome Database (LMPD)
LMPD ID
LMP006791
Gene ID
Species
Homo sapiens (Human)
Gene Name
emopamil binding protein-like
Gene Symbol
Synonyms
EBRP
Alternate Names
emopamil-binding protein-like; emopamil-binding-related protein; emopamil binding related protein, delta8-delta7 sterol isomerase related protein
Chromosome
13
Map Location
13q12-q13
Proteins
| emopamil-binding protein-like isoform 1 | |
|---|---|
| Refseq ID | NP_115954 |
| Protein GI | 14211873 |
| UniProt ID | Q9BY08 |
| mRNA ID | NM_032565 |
| Length | 206 |
| RefSeq Status | VALIDATED |
| MGAEWELGAEAGGSLLLCAALLAAGCALGLRLGRGQGAADRGALIWLCYDALVHFALEGPFVYLSLVGNVANSDGLIASLWKEYGKADARWVYFDPTIVSVEILTVALDGSLALFLIYAIVKEKYYRHFLQITLCVCELYGCWMTFLPEWLTRSPNLNTSNWLYCWLYLFFFNGVWVLIPGLLLWQSWLELKKMHQKETSSVKKFQ | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IDA:HPA | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0047750 | IEA:InterPro | F | cholestenol delta-isomerase activity |
| GO:0016125 | IEA:InterPro | P | sterol metabolic process |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR007905 | Emopamil-binding protein |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=5; Name=1; IsoId=Q9BY08-1; Sequence=Displayed; Name=2; IsoId=Q9BY08-2; Sequence=VSP_035418, VSP_035425; Note=No experimental confirmation available.; Name=3; IsoId=Q9BY08-3; Sequence=VSP_035417, VSP_035422; Note=No experimental confirmation available.; Name=4; IsoId=Q9BY08-4; Sequence=VSP_035419, VSP_035421; Note=No experimental confirmation available.; Name=5; IsoId=Q9BY08-5; Sequence=VSP_035420, VSP_035423, VSP_035424; Note=No experimental confirmation available.; |
| Function | Does not possess sterol isomerase activity and does not bind sigma ligands. |
| Similarity | Belongs to the EBP family. |
| Subcellular Location | Endoplasmic reticulum membrane ; Multi-pass membrane protein . |
| Subunit | Homodimer. |
| Tissue Specificity | Widely expressed with highest levels in liver, lung and kidney. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006791 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 14211873 | RefSeq | NP_115954 | 206 | emopamil-binding protein-like isoform 1 |
Identical Sequences to LMP006791 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:14211873 | EMBL | CBX51362.1 | 206 | unnamed protein product [Homo sapiens] |
| GI:14211873 | GenBank | ACK32507.1 | 206 | Sequence 122 from patent US 7459531 |
| GI:14211873 | GenBank | AEL83431.1 | 206 | Sequence 57 from patent US 7989160 |
| GI:14211873 | GenBank | AGN62190.1 | 206 | Sequence 57 from patent US 8431126 |
| GI:14211873 | GenBank | AGX45907.1 | 206 | Sequence 57 from patent US 8540988 |
| GI:14211873 | GenBank | AHD70092.1 | 206 | Sequence 2181 from patent US 8586006 |
Related Sequences to LMP006791 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:14211873 | GenBank | AAH92471.1 | 206 | Emopamil binding protein-like [Homo sapiens] |
| GI:14211873 | GenBank | JAA04476.1 | 206 | emopamil binding protein-like [Pan troglodytes] |
| GI:14211873 | GenBank | JAA11814.1 | 206 | emopamil binding protein-like [Pan troglodytes] |
| GI:14211873 | GenBank | JAA23503.1 | 206 | emopamil binding protein-like [Pan troglodytes] |
| GI:14211873 | GenBank | JAA37084.1 | 206 | emopamil binding protein-like [Pan troglodytes] |
| GI:14211873 | RefSeq | XP_003809863.1 | 206 | PREDICTED: emopamil-binding protein-like [Pan paniscus] |