Gene/Proteome Database (LMPD)
LMPD ID
LMP006801
Gene ID
Species
Homo sapiens (Human)
Gene Name
StAR-related lipid transfer (START) domain containing 10
Gene Symbol
Synonyms
NY-CO-28; PCTP2; SDCCAG28
Alternate Names
PCTP-like protein; PCTP-L; antigen NY-CO-28; START domain containing 10; START domain-containing protein 10; stAR-related lipid transfer protein 10; serologically defined colon cancer antigen 28
Chromosome
11
Map Location
11q13
Proteins
PCTP-like protein | |
---|---|
Refseq ID | NP_006636 |
Protein GI | 116812600 |
UniProt ID | Q9Y365 |
mRNA ID | NM_006645 |
Length | 291 |
RefSeq Status | VALIDATED |
MEKLAASTEPQGPRPVLGRESVQVPDDQDFRSFRSECEAEVGWNLTYSRAGVSVWVQAVEMDRTLHKIKCRMECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKSCVITYLAQVDPKGSLPKWVVNKSSQFLAPKAMKKMYKACLKYPEWKQKHLPHFKPWLHPEQSPLPSLALSELSVQHADSLENIDESAVAESREERMGGAGGEGSDDDTSLT |
Gene Information
Entrez Gene ID
Gene Name
StAR-related lipid transfer (START) domain containing 10
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005829 | IEA:Ensembl | C | cytosol |
GO:0046581 | IEA:Ensembl | C | intercellular canaliculus |
GO:0016020 | IEA:UniProtKB-KW | C | membrane |
GO:0005902 | IEA:Ensembl | C | microvillus |
GO:0008289 | IEA:UniProtKB-KW | F | lipid binding |
GO:0032782 | IEA:Ensembl | P | bile acid secretion |
GO:0035360 | IEA:Ensembl | P | positive regulation of peroxisome proliferator activated receptor signaling pathway |
Domain Information
UniProt Annotations
Entry Information
Gene Name
StAR-related lipid transfer (START) domain containing 10
Protein Entry
PCTL_HUMAN
UniProt ID
Species
Human
Comments
Comment Type | Description |
---|---|
Function | May play metabolic roles in sperm maturation or fertilization (By similarity). Phospholipid transfer protein that preferentially selects lipid species containing a palmitoyl or stearoyl chain on the sn-1 and an unsaturated fatty acyl chain (18:1 or 18:2) on the sn-2 position. Able to transfer phosphatidylcholine (PC) and phosphatidyetanolamline (PE) between membranes. |
Interaction | Q96LA8:PRMT6; NbExp=2; IntAct=EBI-4289836, EBI-912440; |
Ptm | Phosphorylation at Ser-284 by CK2 negatively regulates lipid transfer activity, possibly by decreasing membrane association. |
Sequence Caution | Sequence=AAC18045.1; Type=Miscellaneous discrepancy; Note=Various sequencing problems as well as a translation in a wrong frame.; Evidence= ; Sequence=AAD34047.1; Type=Erroneous initiation; Evidence= ; |
Similarity | Contains 1 START domain. {ECO |
Subcellular Location | Cell projection, cilium, flagellum {ECO |
Identical and Related Proteins
Unique RefSeq proteins for LMP006801 (as displayed in Record Overview)
Identical Sequences to LMP006801 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:116812600 | GenBank | ADQ32095.1 | 291 | START domain containing 10, partial [synthetic construct] |
GI:116812600 | GenBank | ADT49071.1 | 291 | Sequence 1088 from patent US 7842467 |
GI:116812600 | GenBank | ADT49073.1 | 291 | Sequence 1090 from patent US 7842467 |
GI:116812600 | GenBank | ADT49075.1 | 291 | Sequence 1092 from patent US 7842467 |
GI:116812600 | GenBank | ADT49078.1 | 291 | Sequence 1095 from patent US 7842467 |
GI:116812600 | GenBank | AIC50723.1 | 291 | STARD10, partial [synthetic construct] |
Related Sequences to LMP006801 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:116812600 | DBBJ | BAG53103.1 | 291 | unnamed protein product [Homo sapiens] |
GI:116812600 | GenBank | AAD34047.1 | 359 | CGI-52 protein [Homo sapiens] |
GI:116812600 | GenBank | ADL88055.1 | 359 | Sequence 49 from patent US 7705120 |
GI:116812600 | GenBank | ADT49077.1 | 359 | Sequence 1094 from patent US 7842467 |
GI:116812600 | GenBank | JAA23352.1 | 291 | StAR-related lipid transfer (START) domain containing 10 [Pan troglodytes] |
GI:116812600 | GenBank | JAA34150.1 | 291 | StAR-related lipid transfer (START) domain containing 10 [Pan troglodytes] |