Gene/Proteome Database (LMPD)

LMPD ID
LMP006801
Gene ID
Species
Homo sapiens (Human)
Gene Name
StAR-related lipid transfer (START) domain containing 10
Gene Symbol
Synonyms
NY-CO-28; PCTP2; SDCCAG28
Alternate Names
PCTP-like protein; PCTP-L; antigen NY-CO-28; START domain containing 10; START domain-containing protein 10; stAR-related lipid transfer protein 10; serologically defined colon cancer antigen 28
Chromosome
11
Map Location
11q13

Proteins

PCTP-like protein
Refseq ID NP_006636
Protein GI 116812600
UniProt ID Q9Y365
mRNA ID NM_006645
Length 291
RefSeq Status VALIDATED
MEKLAASTEPQGPRPVLGRESVQVPDDQDFRSFRSECEAEVGWNLTYSRAGVSVWVQAVEMDRTLHKIKCRMECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKSCVITYLAQVDPKGSLPKWVVNKSSQFLAPKAMKKMYKACLKYPEWKQKHLPHFKPWLHPEQSPLPSLALSELSVQHADSLENIDESAVAESREERMGGAGGEGSDDDTSLT

Gene Information

Entrez Gene ID
Gene Name
StAR-related lipid transfer (START) domain containing 10
Gene Symbol
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005829 IEA:Ensembl C cytosol
GO:0046581 IEA:Ensembl C intercellular canaliculus
GO:0016020 IEA:UniProtKB-KW C membrane
GO:0005902 IEA:Ensembl C microvillus
GO:0008289 IEA:UniProtKB-KW F lipid binding
GO:0032782 IEA:Ensembl P bile acid secretion
GO:0035360 IEA:Ensembl P positive regulation of peroxisome proliferator activated receptor signaling pathway

Domain Information

InterPro Annotations

Accession Description
IPR023393 START-like domain
IPR002913 START_lipid-bd_dom

UniProt Annotations

Entry Information

Gene Name
StAR-related lipid transfer (START) domain containing 10
Protein Entry
PCTL_HUMAN
UniProt ID
Species
Human

Comments

Comment Type Description
Function May play metabolic roles in sperm maturation or fertilization (By similarity). Phospholipid transfer protein that preferentially selects lipid species containing a palmitoyl or stearoyl chain on the sn-1 and an unsaturated fatty acyl chain (18:1 or 18:2) on the sn-2 position. Able to transfer phosphatidylcholine (PC) and phosphatidyetanolamline (PE) between membranes.
Interaction Q96LA8:PRMT6; NbExp=2; IntAct=EBI-4289836, EBI-912440;
Ptm Phosphorylation at Ser-284 by CK2 negatively regulates lipid transfer activity, possibly by decreasing membrane association.
Sequence Caution Sequence=AAC18045.1; Type=Miscellaneous discrepancy; Note=Various sequencing problems as well as a translation in a wrong frame.; Evidence= ; Sequence=AAD34047.1; Type=Erroneous initiation; Evidence= ;
Similarity Contains 1 START domain. {ECO
Subcellular Location Cell projection, cilium, flagellum {ECO

Identical and Related Proteins

Unique RefSeq proteins for LMP006801 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
116812600 RefSeq NP_006636 291 PCTP-like protein

Identical Sequences to LMP006801 proteins

Reference Database Accession Length Protein Name
GI:116812600 GenBank ADQ32095.1 291 START domain containing 10, partial [synthetic construct]
GI:116812600 GenBank ADT49071.1 291 Sequence 1088 from patent US 7842467
GI:116812600 GenBank ADT49073.1 291 Sequence 1090 from patent US 7842467
GI:116812600 GenBank ADT49075.1 291 Sequence 1092 from patent US 7842467
GI:116812600 GenBank ADT49078.1 291 Sequence 1095 from patent US 7842467
GI:116812600 GenBank AIC50723.1 291 STARD10, partial [synthetic construct]

Related Sequences to LMP006801 proteins

Reference Database Accession Length Protein Name
GI:116812600 DBBJ BAG53103.1 291 unnamed protein product [Homo sapiens]
GI:116812600 GenBank AAD34047.1 359 CGI-52 protein [Homo sapiens]
GI:116812600 GenBank ADL88055.1 359 Sequence 49 from patent US 7705120
GI:116812600 GenBank ADT49077.1 359 Sequence 1094 from patent US 7842467
GI:116812600 GenBank JAA23352.1 291 StAR-related lipid transfer (START) domain containing 10 [Pan troglodytes]
GI:116812600 GenBank JAA34150.1 291 StAR-related lipid transfer (START) domain containing 10 [Pan troglodytes]